Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (42.68kD).)

Mouse MTAP Monoclonal Antibody | anti-MTAP antibody

MTAP (methylthioadenosine phosphorylase, 5'-methylthioadenosine phosphorylase, c86fus, MSAP, MTAPase, MTA Phosphorylase, S-methyl-5'-thioadenosine Phosphorylase) (AP)

Gene Names
MTAP; BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTAP; Monoclonal Antibody; MTAP (methylthioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; c86fus; MSAP; MTAPase; MTA Phosphorylase; S-methyl-5'-thioadenosine Phosphorylase) (AP); anti-MTAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G4
Specificity
Recognizes human MTAP. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MTAP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-154 from human MTAP (AAH18625) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.68kD).)

Western Blot (WB) (Western Blot detection against Immunogen (42.68kD).)

Western Blot (WB)

(MTAP monoclonal antibody Western Blot analysis of MTAP expression in HeLa.)

Western Blot (WB) (MTAP monoclonal antibody Western Blot analysis of MTAP expression in HeLa.)

Western Blot (WB)

(MTAP monoclonal antibody. Western Blot analysis of MTAP expression in PC-12.)

Western Blot (WB) (MTAP monoclonal antibody. Western Blot analysis of MTAP expression in PC-12.)

Western Blot (WB)

(MTAP monoclonal antibody. Western Blot analysis of MTAP expression in Raw 264.7.)

Western Blot (WB) (MTAP monoclonal antibody. Western Blot analysis of MTAP expression in Raw 264.7.)

Western Blot (WB)

(MTAP monoclonal antibody. Western Blot analysis of MTAP expression in NIH/3T3.)

Western Blot (WB) (MTAP monoclonal antibody. Western Blot analysis of MTAP expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MTAP is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MTAP is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-MTAP antibody
References
1. Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression. Rose AE, Poliseno L, Wang J, Clark M, Pearlman A, Wang G, Vega Y Saenz de Miera EC, Medicherla R, Christos PJ, Shapiro RL, Pavlick AC, Darvishian F, Zavadil J, Polsky D, Hernando E, Ostrer H, Osman I.Cancer Res. 2011 Feb 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26,278 Da
NCBI Official Full Name
Homo sapiens methylthioadenosine phosphorylase, mRNA
NCBI Official Synonym Full Names
methylthioadenosine phosphorylase
NCBI Official Symbol
MTAP
NCBI Official Synonym Symbols
BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249
NCBI Protein Information
S-methyl-5'-thioadenosine phosphorylase

NCBI Description

This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq, Jul 2008]

Research Articles on MTAP

Similar Products

Product Notes

The MTAP (Catalog #AAA6132410) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTAP (methylthioadenosine phosphorylase, 5'-methylthioadenosine phosphorylase, c86fus, MSAP, MTAPase, MTA Phosphorylase, S-methyl-5'-thioadenosine Phosphorylase) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTAP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.