Western Blot (WB)
(Western Blot detection against Immunogen (32.4kD).)
Mouse anti-Human MT2A Monoclonal Antibody | anti-MT2A antibody
MT2A (Metallothionein-2, MT-2, Metallothionein-2A, Metallothionein-II, MT-II, CES1, MT2)
Gene Names
MT2A; MT2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MT2A; Monoclonal Antibody; MT2A (Metallothionein-2; MT-2; Metallothionein-2A; Metallothionein-II; MT-II; CES1; MT2); Anti -MT2A (Metallothionein-2; anti-MT2A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a Lambda
Clone Number
6G2
Specificity
Recognizes human MT2A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Applicable Applications for anti-MT2A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-61 from human MT2A (NP_005944.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (32.4kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (32.4kD).)
Testing Data
(Detection limit for recombinant GST tagged MT2A is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MT2A is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MT2A antibody
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Product Categories/Family for anti-MT2A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
6,042 Da
NCBI Official Full Name
metallothionein-2
NCBI Official Synonym Full Names
metallothionein 2A
NCBI Official Symbol
MT2A
NCBI Official Synonym Symbols
MT2
NCBI Protein Information
metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
UniProt Protein Name
Metallothionein-2
Protein Family
UniProt Gene Name
MT2A
UniProt Synonym Gene Names
CES1; MT2; MT-2; MT-II
UniProt Entry Name
MT2_HUMAN
Uniprot Description
Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Domain: Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
Miscellaneous: This metallothionein binds zinc.
Sequence similarities: Belongs to the metallothionein superfamily. Type 1 family.
Research Articles on MT2A
Similar Products
Product Notes
The MT2A mt2a (Catalog #AAA649876) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MT2A (Metallothionein-2, MT-2, Metallothionein-2A, Metallothionein-II, MT-II, CES1, MT2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MT2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the MT2A mt2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDPNCSCAAG DSCTCAGSCK CKECKCTSCK KSCCSCCPVG CAKCAQGCIC KGASDKCSCC A. It is sometimes possible for the material contained within the vial of "MT2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
