Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human MSH6 Monoclonal Antibody | anti-MSH6 antibody

MSH6 (DNA Mismatch Repair Protein Msh6, hMSH6, G/T Mismatch-binding Protein, GTBP, GTMBP, MutS-alpha 160kD Subunit, p160, GTBP) (FITC)

Gene Names
MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSH6; Monoclonal Antibody; MSH6 (DNA Mismatch Repair Protein Msh6; hMSH6; G/T Mismatch-binding Protein; GTBP; GTMBP; MutS-alpha 160kD Subunit; p160; GTBP) (FITC); anti-MSH6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F2
Specificity
Recognizes human MSH6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MSH6 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa931-1030 from human MSH6 (NP_000170) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(MSH6 monoclonal antibody. Western Blot analysis of MSH6 expression in human kidney.)

Western Blot (WB) (MSH6 monoclonal antibody. Western Blot analysis of MSH6 expression in human kidney.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MSH6 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MSH6 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MSH6 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MSH6 is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MSH2 and MSH6 HeLa cells were stained with MSH2 rabbit purified polyclonal 1:1200 and MSH6 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MSH2 and MSH6 HeLa cells were stained with MSH2 rabbit purified polyclonal 1:1200 and MSH6 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-MSH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
119,796 Da
NCBI Official Full Name
DNA mismatch repair protein Msh6 isoform 1
NCBI Official Synonym Full Names
mutS homolog 6
NCBI Official Symbol
MSH6
NCBI Official Synonym Symbols
GTBP; HSAP; p160; GTMBP; HNPCC5
NCBI Protein Information
DNA mismatch repair protein Msh6; G/T mismatch-binding protein; mutS-alpha 160 kDa subunit; sperm-associated protein
UniProt Protein Name
DNA mismatch repair protein Msh6
UniProt Gene Name
MSH6
UniProt Synonym Gene Names
GTBP; hMSH6; GTBP; GTMBP; p160
UniProt Entry Name
MSH6_HUMAN

Similar Products

Product Notes

The MSH6 msh6 (Catalog #AAA6148306) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSH6 (DNA Mismatch Repair Protein Msh6, hMSH6, G/T Mismatch-binding Protein, GTBP, GTMBP, MutS-alpha 160kD Subunit, p160, GTBP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSH6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSH6 msh6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSH6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.