Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human MSC Monoclonal Antibody | anti-MSC antibody

MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) APC

Gene Names
MSC; ABF1; MYOR; ABF-1; bHLHa22
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSC; Monoclonal Antibody; MSC (ABF1; BHLHA22; Musculin; Activated B Cell Factor 1; Class A Basic Helix-loop-helix Protein 22) APC; anti-MSC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D7
Specificity
Recognizes human MSC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2075
Applicable Applications for anti-MSC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from MSC (NP_005089) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of MSC expression in transfected 293T cell line by MSC monoclonal antibody Lane 1: MSC transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MSC expression in transfected 293T cell line by MSC monoclonal antibody Lane 1: MSC transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MSC antibody
The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq].
Product Categories/Family for anti-MSC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens musculin (MSC), mRNA
NCBI Official Synonym Full Names
musculin
NCBI Official Symbol
MSC
NCBI Official Synonym Symbols
ABF1; MYOR; ABF-1; bHLHa22
NCBI Protein Information
musculin
UniProt Protein Name
Musculin
Protein Family
UniProt Gene Name
MSC
UniProt Synonym Gene Names
ABF1; BHLHA22; ABF-1; bHLHa22
UniProt Entry Name
MUSC_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

MSC: Transcription repressor capable of inhibiting the transactivation capability of TCF3/E47. May play a role in regulating antigen-dependent B-cell differentiation.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: nucleus

Molecular Function: protein dimerization activity; transcription corepressor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; branchiomeric skeletal muscle development; negative regulation of transcription from RNA polymerase II promoter; palate development

Research Articles on MSC

Similar Products

Product Notes

The MSC msc (Catalog #AAA6137697) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSC msc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.