Mouse anti-Human MRPS36 Monoclonal Antibody | anti-MRPS36 antibody

MRPS36 (28S Ribosomal Protein S36, Mitochondrial, MRP-S36, S36mt, DC47, MGC22896) (HRP)

Cat. Num. AAA6153597

• Gene Names: MRPS36; DC47; MRP-S36
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MRPS36; Monoclonal Antibody; MRPS36 (28S Ribosomal Protein S36; Mitochondrial; MRP-S36; S36mt; DC47; MGC22896) (HRP); anti-MRPS36 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E11
• Specificity: Recognizes human MRPS36.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MRPS36 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-103 from human MRPS36 (NP_150597) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.5kD).)

Testing Data

(Detection limit for recombinant GST tagged MRPS36 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MRPS36 antibody

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Product Categories/Family for anti-MRPS36 antibody

Antibodies; Mitochondrial Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15150811
• NCBI GeneID: 92259
• NCBI Accession #: NP_150597.1
• NCBI GenBank Nucleotide #: NM_033281
• UniProt Accession #: P82909; Q9H2H4
• Molecular Weight: 11,466 Da
• NCBI Official Full Name: 28S ribosomal protein S36, mitochondrial
• NCBI Official Synonym Full Names: mitochondrial ribosomal protein S36
• NCBI Official Symbol: MRPS36
• NCBI Official Synonym Symbols: DC47; MRP-S36
• NCBI Protein Information: 28S ribosomal protein S36, mitochondrial; S36mt
• UniProt Protein Name: 28S ribosomal protein S36, mitochondrial
• Protein Family: 28S ribosomal protein
• UniProt Gene Name: MRPS36
• UniProt Synonym Gene Names: MRP-S36; S36mt
• UniProt Entry Name: RT36_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPS36: Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein type: Ribosomal; Translation; Mitochondrial

Chromosomal Location of Human Ortholog: 5q13.2

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial small ribosomal subunit

Molecular Function: structural constituent of ribosome

Biological Process: mitochondrial translation; translation; organelle organization and biogenesis