Mouse MR1 Monoclonal Antibody | anti-MR1 antibody

MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (PE)

Cat. Num. AAA6187141

• Gene Names: MR1; HLALS
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MR1; Monoclonal Antibody; MR1 (Major Histocompatibility Complex; Class I-Related; HLALS) (PE); Major Histocompatibility Complex; HLALS; anti-MR1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B5
• Specificity: Recognizes MR1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MR1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MR1 (NP_001522, 201aa-300aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MR1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MR1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-MR1 antibody

Mouse monoclonal antibody raised against a partial recombinant MR1.

Product Categories/Family for anti-MR1 antibody

Antibodies; HLA

NCBI and Uniprot Product Information

• NCBI GI #: 4504417
• NCBI GeneID: 3140
• NCBI Accession #: NP_001522
• NCBI GenBank Nucleotide #: NM_001194999
• UniProt Accession #: Q95460
• Molecular Weight: 43
• NCBI Official Full Name: major histocompatibility complex class I-related gene protein isoform 1
• NCBI Official Synonym Full Names: major histocompatibility complex, class I-related
• NCBI Official Symbol: MR1
• NCBI Official Synonym Symbols: HLALS
• NCBI Protein Information: major histocompatibility complex class I-related gene protein
• UniProt Protein Name: Major histocompatibility complex class I-related gene protein
• Protein Family: Major histocompatibility complex class I-related gene protein
• UniProt Gene Name: MR1
• UniProt Synonym Gene Names: MHC class I-related gene protein
• UniProt Entry Name: HMR1_HUMAN

NCBI Description

MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. [provided by RefSeq, Jul 2015]

Uniprot Description

MR1: Has antigen presentation function. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT cells are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand- dependent. Belongs to the MHC class I family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q25.3

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; extracellular region; integral to membrane; plasma membrane; MHC class I protein complex

Molecular Function: MHC class I receptor activity; peptide antigen binding; antigen binding

Biological Process: antigen processing and presentation; antigen processing and presentation of peptide antigen via MHC class I; positive regulation of T cell mediated cytotoxicity; interleukin-17 production; interleukin-1 beta production; innate immune response; immune response; cytokine production during immune response; signal transduction; defense response to Gram-negative bacterium