Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MPST Monoclonal Antibody | anti-MPST antibody

MPST (3-Mercaptopyruvate Sulfurtransferase, Mercaptopyruvate Sulfurtransferase, MST, MGC24539, TST2) (MaxLight 750)

Gene Names
MPST; MST; TST2; TUM1
Reactivity
Human
Applications
Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MPST; Monoclonal Antibody; MPST (3-Mercaptopyruvate Sulfurtransferase; Mercaptopyruvate Sulfurtransferase; MST; MGC24539; TST2) (MaxLight 750); anti-MPST antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B5
Specificity
Recognizes human MPST.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-MPST antibody
FLISA, Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human MPST (NP_001013454.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MPST antibody
MPST catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU).
Product Categories/Family for anti-MPST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
3-mercaptopyruvate sulfurtransferase isoform 2
NCBI Official Synonym Full Names
mercaptopyruvate sulfurtransferase
NCBI Official Symbol
MPST
NCBI Official Synonym Symbols
MST; TST2; TUM1
NCBI Protein Information
3-mercaptopyruvate sulfurtransferase; human liver rhodanese; tRNA thiouridin modification protein 1
UniProt Protein Name
3-mercaptopyruvate sulfurtransferase
UniProt Gene Name
MPST
UniProt Synonym Gene Names
TST2; MST
UniProt Entry Name
THTM_HUMAN

NCBI Description

This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MPST: Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.

Protein type: Transferase; Amino Acid Metabolism - cysteine and methionine; EC 2.8.1.2; Mitochondrial

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: neuron projection; mitochondrial inner membrane; synapse; cell junction

Molecular Function: 3-mercaptopyruvate sulfurtransferase activity; thiosulfate sulfurtransferase activity

Biological Process: cyanate catabolic process; response to toxin

Research Articles on MPST

Similar Products

Product Notes

The MPST mpst (Catalog #AAA6233931) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MPST (3-Mercaptopyruvate Sulfurtransferase, Mercaptopyruvate Sulfurtransferase, MST, MGC24539, TST2) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MPST can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MPST mpst for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MPST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.