Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Mouse anti-Human MORG1 Monoclonal Antibody | anti-MORG1 antibody

MORG1 (Mitogen-activated Protein Kinase Organizer 1, MAPK Organizer 1, WD Repeat Domain-containing Protein 83, WDR83, MGC4238) (Biotin)

Gene Names
WDR83; MORG1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MORG1; Monoclonal Antibody; MORG1 (Mitogen-activated Protein Kinase Organizer 1; MAPK Organizer 1; WD Repeat Domain-containing Protein 83; WDR83; MGC4238) (Biotin); anti-MORG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E12
Specificity
Recognizes human MORG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MORG1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa171-263 from human MORG1 (NP_115708) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFW
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.86kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Testing Data

(Detection limit for recombinant GST tagged MORG1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MORG1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-MORG1 antibody
Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator. May also be involved in pre-mRNA splicing.
Product Categories/Family for anti-MORG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
WD repeat domain-containing protein 83
NCBI Official Synonym Full Names
WD repeat domain 83
NCBI Official Symbol
WDR83
NCBI Official Synonym Symbols
MORG1
NCBI Protein Information
WD repeat domain-containing protein 83
UniProt Protein Name
WD repeat domain-containing protein 83
UniProt Gene Name
WDR83
UniProt Synonym Gene Names
MORG1; MAPK organizer 1
UniProt Entry Name
WDR83_HUMAN

NCBI Description

This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

MORG1: Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator. May also be involved in pre-mRNA splicing. Belongs to the WD repeat MORG1 family.

Protein type: Spliceosome; RNA processing

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: spliceosome; cytoplasm

Molecular Function: protein binding

Biological Process: RNA splicing, via transesterification reactions; nuclear mRNA splicing, via spliceosome

Research Articles on MORG1

Similar Products

Product Notes

The MORG1 wdr83 (Catalog #AAA6142962) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MORG1 (Mitogen-activated Protein Kinase Organizer 1, MAPK Organizer 1, WD Repeat Domain-containing Protein 83, WDR83, MGC4238) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MORG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MORG1 wdr83 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MORG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.