Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse anti-Human MORC1 Monoclonal Antibody | anti-MORC1 antibody
MORC1 (MORC Family CW-type Zinc Finger Protein 1, Cancer/Testis Antigen 33, CT33, MORC) (HRP)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MORC1; Monoclonal Antibody; MORC1 (MORC Family CW-type Zinc Finger Protein 1; Cancer/Testis Antigen 33; CT33; MORC) (HRP); anti-MORC1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E8
Specificity
Recognizes human MORC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
984
Applicable Applications for anti-MORC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human MORC1 (NP_055244) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(MORC1 monoclonal antibody. Western Blot analysis of MORC1 expression in HepG2.)
Western Blot (WB)
(MORC1 monoclonal antibody. Western Blot analysis of MORC1 expression in HepG2.)
Testing Data
(Detection limit for recombinant GST tagged MORC1 is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MORC1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MORC1 antibody
MORC1 is the Human homolog of Mouse MORC and like the mouse protein it is testis-specific. Mouse studies support a testis-specific function since only male knockout mice are infertile; infertility is the only apparent defect. These studies further support a role for this protein early in spermatogenesis, possibly by affecting entry into apoptosis because testis from knockout mice show greatly increased numbers of apoptotic cells.
Product Categories/Family for anti-MORC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
MORC family CW-type zinc finger protein 1
UniProt Protein Name
MORC family CW-type zinc finger protein 1
Protein Family
UniProt Gene Name
MORC1
UniProt Synonym Gene Names
MORC; CT33
UniProt Entry Name
MORC1_HUMAN
Similar Products
Product Notes
The MORC1 morc1 (Catalog #AAA6153567) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MORC1 (MORC Family CW-type Zinc Finger Protein 1, Cancer/Testis Antigen 33, CT33, MORC) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MORC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MORC1 morc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MORC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
