Mouse anti-Human MOB1B Monoclonal Antibody | anti-MOB1B antibody
MOB1B (MOB Kinase Activator 1B, Mob1 Homolog 1A, Mob1A, Mob1B, Mps One Binder Kinase Activator-like 1A, MOB4A, MOBKL1A, MGC33910) (PE)
Gene Names
MOB1B; MATS2; MOB4A; MOBKL1A
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MOB1B; Monoclonal Antibody; MOB1B (MOB Kinase Activator 1B; Mob1 Homolog 1A; Mob1A; Mob1B; Mps One Binder Kinase Activator-like 1A; MOB4A; MOBKL1A; MGC33910) (PE); anti-MOB1B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F8
Specificity
Recognizes human MOBKL1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MOB1B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa120-217 from human MOBKL1A (NP_775739) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MOB1B antibody
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L.
Product Categories/Family for anti-MOB1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,499 Da
NCBI Official Full Name
MOB kinase activator 1B isoform 2
NCBI Official Synonym Full Names
MOB kinase activator 1B
NCBI Official Symbol
MOB1B
NCBI Official Synonym Symbols
MATS2; MOB4A; MOBKL1A
NCBI Protein Information
MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A
Protein Family
NCBI Description
The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Research Articles on MOB1B
Similar Products
Product Notes
The MOB1B (Catalog #AAA6158865) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MOB1B (MOB Kinase Activator 1B, Mob1 Homolog 1A, Mob1A, Mob1B, Mps One Binder Kinase Activator-like 1A, MOB4A, MOBKL1A, MGC33910) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOB1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MOB1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MOB1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
