Mouse anti-Human MMP13 Monoclonal Antibody | anti-MMP13 antibody

MMP13 (Collagenase 3, Matrix Metalloproteinase-13, MMP-13) (HRP)

Cat. Num. AAA6153554

• Gene Names: MMP13; CLG3; MDST; MANDP1; MMP-13
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP13; Monoclonal Antibody; MMP13 (Collagenase 3; Matrix Metalloproteinase-13; MMP-13) (HRP); anti-MMP13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B11
• Specificity: Recognizes human MMP13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MMP13 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa362-471 from human MMP13 (NP_002418) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of MMP13 expression in transfected 293T cell line by MMP13 monoclonal antibody. Lane 1: MMP13 transfected lysate (53.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MMP13 transfected lysate using anti-MMP13 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP13 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MMP13 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MMP13 over-expressed 293 cell line, cotransfected with MMP13 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MMP13 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-MMP13 antibody

The matrix metalloproteinases (MMP) are a family of peptidase enzymes responsible for the degradation of extracellular matrix components, including collagen, gelatin, fibronectin, laminin and proteoglycan. Transcription of MMP genes is differentially activated by phorbol ester, lipopolysaccharide (LPS) or staphylococcal enterotoxin B (SEB). MMP catalysis requires both calcium and zinc. MMP-13 (also designated collagenase-3) is produced by breast carcinomas and degrades collagen type I, II, III.

Product Categories/Family for anti-MMP13 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505209
• NCBI GeneID: 4322
• NCBI Accession #: NP_002418
• NCBI GenBank Nucleotide #: NM_002427
• UniProt Accession #: P45452; Q6NWN6; A8K846; B2RCZ3
• Molecular Weight: 44.7 kDa (391aa) confirmed by MALDI-TOF
• NCBI Official Full Name: collagenase 3 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 13
• NCBI Official Symbol: MMP13
• NCBI Official Synonym Symbols: CLG3; MDST; MANDP1; MMP-13
• NCBI Protein Information: collagenase 3
• UniProt Protein Name: Collagenase 3
• Protein Family: Collagenase
• UniProt Gene Name: MMP13
• UniProt Synonym Gene Names: MMP-13
• UniProt Entry Name: MMP13_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP13: Degrades collagen type I. Does not act on gelatin or casein. Could have a role in tumoral process. Defects in MMP13 are the cause of spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO). A bone disease characterized by moderate to severe metaphyseal changes, mild epiphyseal involvement, rhizomelic shortening of the lower limbs with bowing of the femora and/or tibiae, coxa vara, genu varum and pear-shaped vertebrae in childhood. Epimetaphyseal changes improve with age. Defects in MMP13 are the cause of metaphyseal anadysplasia type 1 (MANDP1). Metaphyseal anadysplasia consists of an abnormal bone development characterized by severe skeletal changes that, in contrast with the progressive course of most other skeletal dysplasias, resolve spontaneously with age. Clinical characteristics are evident from the first months of life and include slight shortness of stature and a mild varus deformity of the legs. Patients attain a normal stature in adolescence and show improvement or complete resolution of varus deformity of the legs and rhizomelic micromelia. Belongs to the peptidase M10A family.

Protein type: Secreted; Secreted, signal peptide; EC 3.4.24.-; Protease

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: collagen binding; zinc ion binding; metalloendopeptidase activity; calcium ion binding

Biological Process: collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; cellular protein metabolic process; proteolysis; bone mineralization; endochondral ossification

Disease: Spondyloepimetaphyseal Dysplasia, Missouri Type