Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MLL4 is approximately 0.03ng/ml as a capture antibody.)

Mouse MLL4 Monoclonal Antibody | anti-MLL4 antibody

MLL4 (Myeloid/Lymphoid or Mixed-Lineage Leukemia 4, HRX2, KIAA0304, MLL2, TRX2, WBP7) (HRP)

Gene Names
KMT2B; HRX2; MLL2; MLL4; TRX2; WBP7; DYT28; MLL1B; WBP-7; CXXC10
Applications
Western Blot
Purity
Purified
Synonyms
MLL4; Monoclonal Antibody; MLL4 (Myeloid/Lymphoid or Mixed-Lineage Leukemia 4; HRX2; KIAA0304; MLL2; TRX2; WBP7) (HRP); Myeloid/Lymphoid or Mixed-Lineage Leukemia 4; WBP7; anti-MLL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C10
Specificity
Recognizes MLL4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2715
Applicable Applications for anti-MLL4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MLL4 (NP_055542, 813aa-904aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MLL4 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MLL4 is approximately 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-MLL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
histone-lysine N-methyltransferase 2B
NCBI Official Synonym Full Names
lysine methyltransferase 2B
NCBI Official Symbol
KMT2B
NCBI Official Synonym Symbols
HRX2; MLL2; MLL4; TRX2; WBP7; DYT28; MLL1B; WBP-7; CXXC10
NCBI Protein Information
histone-lysine N-methyltransferase 2B
UniProt Protein Name
Histone-lysine N-methyltransferase 2B
UniProt Gene Name
KMT2B
UniProt Synonym Gene Names
HRX2; KIAA0304; MLL2; MLL4; TRX2; WBP7; Lysine N-methyltransferase 2B; WBP-7
UniProt Entry Name
KMT2B_HUMAN

NCBI Description

This gene encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

MLL2: may be a transcriptional regulator. Contains 3 A.T hook DNA-binding domains. Two alternatively spliced isoforms have been described.

Protein type: Methyltransferase; EC 2.1.1.43; Transcription factor; Methyltransferase, protein lysine; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: nucleoplasm; histone methyltransferase complex; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone lysine N-methyltransferase activity (H3-K4 specific); transcription factor activity

Biological Process: ovulation; establishment and/or maintenance of chromatin architecture; ovarian follicle development; transcription, DNA-dependent; chromatin-mediated maintenance of transcription; histone H3-K4 methylation; oocyte differentiation; regulation of histone H3-K4 methylation; gene silencing

Research Articles on MLL4

Similar Products

Product Notes

The MLL4 kmt2b (Catalog #AAA6179476) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MLL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MLL4 kmt2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.