Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MLK3 Monoclonal Antibody | anti-MLK3 antibody

MLK3 (Mixed Lineage Kinase 3, MLK-3, Mitogen-activated Protein Kinase Kinase Kinase 11, MAP3K11, MEKK11, PTK1, Src-homology 3 Domain-containing Proline-rich Kinase, SPRK, MGC17114) (MaxLight 650)

Gene Names
MAP3K11; MLK3; PTK1; SPRK; MLK-3; MEKK11
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MLK3; Monoclonal Antibody; MLK3 (Mixed Lineage Kinase 3; MLK-3; Mitogen-activated Protein Kinase Kinase Kinase 11; MAP3K11; MEKK11; PTK1; Src-homology 3 Domain-containing Proline-rich Kinase; SPRK; MGC17114) (MaxLight 650); anti-MLK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D11
Specificity
Recognizes human MAP3K11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-MLK3 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa741-847 from human MAP3K11 (NP_002410) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-MLK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 11
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 11
NCBI Official Symbol
MAP3K11
NCBI Official Synonym Symbols
MLK3; PTK1; SPRK; MLK-3; MEKK11
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 11
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 11
UniProt Gene Name
MAP3K11
UniProt Entry Name
M3K11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. [provided by RefSeq, Jul 2008]

Uniprot Description

MLK3: a TKL kinase of the MLK family. Has an amino-terminal SH3 domain followed by the kinase domain, two leucine zipper domains, a cdc42/Rac1 binding (CRIB) domain and several other domains/motifs at the carboxy-terminal region. Phosphorylates IkappaB and activates SEK1 and MKK7.

Protein type: EC 2.7.11.25; Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; MLK family; MLK subfamily

Chromosomal Location of Human Ortholog: 11q13.1-q13.3

Cellular Component: centrosome; cytoplasm; membrane; microtubule

Molecular Function: ATP binding; identical protein binding; JUN kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; mitogen-activated protein kinase kinase kinase binding; protein binding; protein homodimerization activity; protein kinase activity; protein serine/threonine kinase activity; protein-tyrosine kinase activity; Rac GTPase binding

Biological Process: activation of JNK activity; activation of JNKK activity; activation of MAPK activity; cell death; cell proliferation; JNK cascade; microtubule-based process; peptidyl-tyrosine phosphorylation; positive regulation of JNK activity; positive regulation of JNK cascade; positive regulation of neuron apoptosis; protein amino acid autophosphorylation; protein amino acid phosphorylation

Research Articles on MLK3

Similar Products

Product Notes

The MLK3 map3k11 (Catalog #AAA6223222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MLK3 (Mixed Lineage Kinase 3, MLK-3, Mitogen-activated Protein Kinase Kinase Kinase 11, MAP3K11, MEKK11, PTK1, Src-homology 3 Domain-containing Proline-rich Kinase, SPRK, MGC17114) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MLK3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MLK3 map3k11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.