Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is ~1ng/ml using 129590 as a capture antibody.)

Mouse anti-Human Mesothelin Monoclonal Antibody | anti-MSLN antibody

Mesothelin (Mesothelin Isoform 1 Precursor, MSLN, CAK1, CAK1 Antigen, Megakaryocyte Potentiating Factor, MPF, Pre-Pro-Megakaryocyte-Potentiating Factor, SMR) APC

Gene Names
MSLN; MPF; SMRP
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Mesothelin; Monoclonal Antibody; Mesothelin (Mesothelin Isoform 1 Precursor; MSLN; CAK1; CAK1 Antigen; Megakaryocyte Potentiating Factor; MPF; Pre-Pro-Megakaryocyte-Potentiating Factor; SMR) APC; anti-MSLN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A10
Specificity
Recognizes human Mesothelin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MSLN antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa464-563 from human Mesothelin with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit is ~1ng/ml using 129590 as a capture antibody.)

Testing Data (Detection limit is ~1ng/ml using 129590 as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of MSLN transfected lysate using 129590 and Protein A Magnetic Bead, and immunoblotted with MSLN rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MSLN transfected lysate using 129590 and Protein A Magnetic Bead, and immunoblotted with MSLN rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot detection against immunogen using 129590 (37.11kD).)

Western Blot (WB) (Western Blot detection against immunogen using 129590 (37.11kD).)
Related Product Information for anti-MSLN antibody
Mesothelin is a glycocylphosphotidylianositol-linked cell-surface glycoprotein, present on the surface of normal mesothelium and is overexpressed in many patients with epithelial ovarian cancer and malignant mesotheliomas.
Product Categories/Family for anti-MSLN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
mesothelin isoform 1 preproprotein
NCBI Official Synonym Full Names
mesothelin
NCBI Official Symbol
MSLN
NCBI Official Synonym Symbols
MPF; SMRP
NCBI Protein Information
mesothelin
UniProt Protein Name
Mesothelin
Protein Family
UniProt Gene Name
MSLN
UniProt Synonym Gene Names
MPF; MPF
UniProt Entry Name
MSLN_HUMAN

NCBI Description

This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone marrow megakaryocytes. Mesothelin is a glycosylphosphatidylinositol-anchored cell-surface protein that may function as a cell adhesion protein. This protein is overexpressed in epithelial mesotheliomas, ovarian cancers and in specific squamous cell carcinomas. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

MSLN: Membrane-anchored forms may play a role in cellular adhesion. Antibodies against MSLN are detected in patients with mesothelioma and ovarian cancer. Belongs to the mesothelin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell adhesion

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: Golgi apparatus; extracellular space; cell surface; membrane; plasma membrane

Molecular Function: protein binding

Biological Process: pancreas development; cell adhesion

Research Articles on MSLN

Similar Products

Product Notes

The MSLN msln (Catalog #AAA6137591) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mesothelin (Mesothelin Isoform 1 Precursor, MSLN, CAK1, CAK1 Antigen, Megakaryocyte Potentiating Factor, MPF, Pre-Pro-Megakaryocyte-Potentiating Factor, SMR) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Mesothelin can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSLN msln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Mesothelin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.