Mouse anti-Human MEF2D Monoclonal Antibody | anti-MEF2D antibody

MEF2D (Myocyte-specific Enhancer Factor 2D, DKFZp686I1536) (AP)

Cat. Num. AAA6132279

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MEF2D; Monoclonal Antibody; MEF2D (Myocyte-specific Enhancer Factor 2D; DKFZp686I1536) (AP); anti-MEF2D antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D6
• Specificity: Recognizes human MEF2D.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-MEF2D antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant corresponding to aa256-351 from human MEF2D (NP_005911) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(MEF2D monoclonal antibody Western Blot analysis of MEF2D expression in K-562.)

Related Product Information for anti-MEF2D antibody

MEF2D is a transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor-and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis (By similarity).

Product Categories/Family for anti-MEF2D antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 5174545
• NCBI GeneID: 4209
• NCBI Accession #: NP_005911
• NCBI GenBank Nucleotide #: NM_005920
• UniProt Accession #: Q14814
• Molecular Weight: 56kDa
• NCBI Official Full Name: myocyte-specific enhancer factor 2D isoform 1
• NCBI Official Synonym Full Names: myocyte enhancer factor 2D
• NCBI Official Symbol: MEF2D
• NCBI Protein Information: myocyte-specific enhancer factor 2D
• UniProt Protein Name: Myocyte-specific enhancer factor 2D
• Protein Family: Myocyte-specific enhancer factor
• UniProt Gene Name: MEF2D
• UniProt Entry Name: MEF2D_HUMAN

NCBI Description

This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]

Uniprot Description

MEF2D: transcription factor which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. May be involved in muscle-specific and/or growth factor-related transcription. Six splice-variant isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q12-q23

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription activator binding; histone deacetylase binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; adult heart development; osteoblast differentiation; nervous system development; muscle development; apoptosis; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; endochondral ossification