Western Blot (WB)
(MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach.)
Mouse MEF2B Monoclonal Antibody | anti-MEF2B antibody
MEF2B (Myocyte Enhancer Factor 2B, FLJ32599, FLJ46391, MGC189732, MGC189763, RSRFR2) (HRP)
Gene Names
MEF2BNB-MEF2B; MEF2B; LOC729991-MEF2B
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MEF2B; Monoclonal Antibody; MEF2B (Myocyte Enhancer Factor 2B; FLJ32599; FLJ46391; MGC189732; MGC189763; RSRFR2) (HRP); Myocyte Enhancer Factor 2B; RSRFR2; anti-MEF2B antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B5
Specificity
Recognizes MEF2B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MEF2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MEF2B (NP_005910.1, 165aa-235aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach.)
Western Blot (WB)
(MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach.)
Product Categories/Family for anti-MEF2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
myocyte enhancer factor 2B isoform b
NCBI Official Synonym Full Names
MEF2BNB-MEF2B readthrough
NCBI Official Symbol
MEF2BNB-MEF2B
NCBI Official Synonym Symbols
MEF2B; LOC729991-MEF2B
NCBI Protein Information
myocyte enhancer factor 2B; LOC729991-MEF2B readthrough
Protein Family
NCBI Description
This gene represents numerous read-through transcripts that span GeneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitiation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on GeneID:100271849. [provided by RefSeq, Oct 2010]
Research Articles on MEF2B
Similar Products
Product Notes
The MEF2B (Catalog #AAA6180574) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MEF2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEF2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEF2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
