Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEF2A on MCF-7 cell. [antibody concentration 10 ug/ml])

Mouse MEF2A Monoclonal Antibody | anti-MEF2A antibody

MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (PE)

Gene Names
MEF2A; mef2; ADCAD1; RSRFC4; RSRFC9
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MEF2A; Monoclonal Antibody; MEF2A (Myocyte Enhancer Factor 2A; ADCAD1; RSRFC4; RSRFC9) (PE); Myocyte Enhancer Factor 2A; RSRFC9; anti-MEF2A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F8
Specificity
Recognizes MEF2A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MEF2A antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MEF2A (AAH13437, 71aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2A on MCF-7 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEF2A on MCF-7 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2A on MCF-7 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEF2A on MCF-7 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(MEF2A monoclonal antibody (M08), clone 1F8 Western Blot analysis of MEF2A expression in MCF-7 (Cat # L046V1).)

Western Blot (WB) (MEF2A monoclonal antibody (M08), clone 1F8 Western Blot analysis of MEF2A expression in MCF-7 (Cat # L046V1).)

Western Blot (WB)

(MEF2A monoclonal antibody (M08), clone 1F8. Western Blot analysis of MEF2A expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (MEF2A monoclonal antibody (M08), clone 1F8. Western Blot analysis of MEF2A expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged MEF2A is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MEF2A is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MEF2A antibody
The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain. [supplied by OMIM]
Product Categories/Family for anti-MEF2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,570 Da
NCBI Official Full Name
MEF2A protein
NCBI Official Synonym Full Names
myocyte enhancer factor 2A
NCBI Official Symbol
MEF2A
NCBI Official Synonym Symbols
mef2; ADCAD1; RSRFC4; RSRFC9
NCBI Protein Information
myocyte-specific enhancer factor 2A

NCBI Description

The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010]

Research Articles on MEF2A

Similar Products

Product Notes

The MEF2A (Catalog #AAA6184807) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MEF2A can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEF2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEF2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.