Mouse MEF2A Monoclonal Antibody | anti-MEF2A antibody

MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (Biotin)

Cat. Num. AAA6171017

• Gene Names: MEF2A; mef2; ADCAD1; RSRFC4; RSRFC9
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MEF2A; Monoclonal Antibody; MEF2A (Myocyte Enhancer Factor 2A; ADCAD1; RSRFC4; RSRFC9) (Biotin); Myocyte Enhancer Factor 2A; RSRFC9; anti-MEF2A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A7
• Specificity: Recognizes MEF2A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MEF2A antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MEF2A (AAH13437, 71aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MEF2A is approximately 10ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2A on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2A on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-MEF2A antibody

The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain. [supplied by OMIM]

Product Categories/Family for anti-MEF2A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 15488587
• NCBI GeneID: 4205
• Molecular Weight: 45,570 Da
• NCBI Official Full Name: MEF2A protein
• NCBI Official Synonym Full Names: myocyte enhancer factor 2A
• NCBI Official Symbol: MEF2A
• NCBI Official Synonym Symbols: mef2; ADCAD1; RSRFC4; RSRFC9
• NCBI Protein Information: myocyte-specific enhancer factor 2A
• Protein Family: Myocyte-specific enhancer factor

NCBI Description

The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010]