Mouse anti-Human MDM2 Monoclonal Antibody | anti-MDM2 antibody

MDM2 (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) (Biotin)

Cat. Num. AAA6142870

• Gene Names: MDM2; HDMX; hdm2; ACTFS
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MDM2; Monoclonal Antibody; MDM2 (E3 Ubiquitin-protein Ligase Mdm2; Double Minute 2 Protein; Hdm2; Oncoprotein Mdm2; p53-binding Protein Mdm2) (Biotin); anti-MDM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A7
• Specificity: Recognizes human MDM2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MDM2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-200 from human MDM2 (NP_002383) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody. Lane 1: MDM2 transfected lysate (55.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MDM2 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MDM2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2 HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Product Categories/Family for anti-MDM2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 89993689
• NCBI GeneID: 4193
• NCBI Accession #: NP_002383
• NCBI GenBank Nucleotide #: NM_002392
• UniProt Accession #: A7UKX7; F6RKA8; Q00987
• Molecular Weight: 13,133 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase Mdm2 isoform a
• NCBI Official Synonym Full Names: MDM2 proto-oncogene, E3 ubiquitin protein ligase
• NCBI Official Symbol: MDM2
• NCBI Official Synonym Symbols: HDMX; hdm2; ACTFS
• NCBI Protein Information: E3 ubiquitin-protein ligase Mdm2; MDM2 oncogene, E3 ubiquitin protein ligase; Mdm2, p53 E3 ubiquitin protein ligase homolog; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; double minute 2, human homolog of; p53-binding protein; oncoprote
• UniProt Protein Name: Mdm2
• Protein Family: Mdm2-binding protein
• UniProt Gene Name: mdm2
• UniProt Entry Name: A7UKX7_HUMAN