Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged LY86 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human, Mouse MD1 Monoclonal Antibody | anti-MD1 antibody

MD1 (Lymphocyte Antigen 86, Ly-86, Protein MD-1, LY86) (AP)

Gene Names
LY86; MD1; MD-1; MMD-1; dJ80N2.1
Reactivity
Human, Mouse
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MD1; Monoclonal Antibody; MD1 (Lymphocyte Antigen 86; Ly-86; Protein MD-1; LY86) (AP); anti-MD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes human LY86.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MD1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-125 from LY86 (AAH38846) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LY86 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LY86 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-MD1 antibody
Mammalian MD1 is a homolog of chicken MD1, which was previously isolated as a v-myb-regulated gene, since its transcription increases rapidly after v-myb induction. MD1 is a 28kD molecule that is associated at the cell surface with RP105 (CD180). RP105 is a leucine-rich repeat (LRR) molecule that is expressed on B lymphocytes. It was first identified by a mAb that protects spleen B cells from irradiation-induced apoptosis. LRR proteins, such as Toll receptors, have a role in innate immunity. MD1 is primarily expressed by B cells, dendritic cells and monocytes, and promotes the recognition of, and subsequent signaling by LPS in the innate immune system. MD1 does not have any homology to other molecules. MD1 when expressed alone behaves as a secretory protein. Expression of MD1 in a cell increases the expression of RP105.
Product Categories/Family for anti-MD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,906 Da
NCBI Official Full Name
Homo sapiens lymphocyte antigen 86, mRNA
NCBI Official Synonym Full Names
lymphocyte antigen 86
NCBI Official Symbol
LY86
NCBI Official Synonym Symbols
MD1; MD-1; MMD-1; dJ80N2.1
NCBI Protein Information
lymphocyte antigen 86

Research Articles on MD1

Similar Products

Product Notes

The MD1 (Catalog #AAA6132260) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MD1 (Lymphocyte Antigen 86, Ly-86, Protein MD-1, LY86) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.