Mouse anti-Human MCM3AP Monoclonal Antibody | anti-MCM3AP antibody

MCM3AP (80kD MCM3-associated Protein, Protein GANP, GANP, KIAA0572, MAP80, FLJ44336, FLJ45306) (HRP)

Cat. Num. AAA6153467

• Gene Names: MCM3AP; GANP; SAC3; MAP80; PNRIID
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MCM3AP; Monoclonal Antibody; MCM3AP (80kD MCM3-associated Protein; Protein GANP; GANP; KIAA0572; MAP80; FLJ44336; FLJ45306) (HRP); anti-MCM3AP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H3
• Specificity: Recognizes human MCM3AP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2539

• Applicable Applications for anti-MCM3AP antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from MCM3AP (AAH13285) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MCM3AP is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MCM3AP antibody

MCM3AP is a 1980aa protein belonging to the SAC3 family and contains domains for MCM3-binding and RNA-primase activities. It is a potent natural inhibitor of the initiation of DNA replication whose action is mediated by interaction with MCM3. Interaction between MCM3 and MCM3AP is essential for nuclear localization and chromatin binding of MCM3AP. It limits DNA replication to once per cell cycle. MCM3AP is an acetyltransferase that acetylates MCM3. It also plays a role in B cell proliferation, differentiation and MCM3 nuclear localization. It is expressed mostly in germinal centers (GCs) of B cells.

Product Categories/Family for anti-MCM3AP antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40225864
• NCBI GeneID: 8888
• NCBI Official Full Name: Homo sapiens minichromosome maintenance complex component 3 associated protein, mRNA
• NCBI Official Synonym Full Names: minichromosome maintenance complex component 3 associated protein
• NCBI Official Symbol: MCM3AP
• NCBI Official Synonym Symbols: GANP; SAC3; MAP80; PNRIID
• NCBI Protein Information: germinal-center associated nuclear protein
• Protein Family: Germinal-center associated nuclear protein

NCBI Description

The minichromosome maintenance protein 3 (MCM3) is one of the MCM proteins essential for the initiation of DNA replication. The protein encoded by this gene is a MCM3 binding protein. It was reported to have phosphorylation-dependent DNA-primase activity, which was up-regulated in antigen immunization induced germinal center. This protein was demonstrated to be an acetyltransferase that acetylates MCM3 and plays a role in DNA replication. The mutagenesis of a nuclear localization signal of MCM3 affects the binding of this protein with MCM3, suggesting that this protein may also facilitate MCM3 nuclear localization. This gene is expressed in the brain or in neuronal tissue. An allelic variant encoding amino acid Lys at 915, instead of conserved Glu, has been identified in patients with mild intellectual disability. [provided by RefSeq, Jan 2014]