Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell. [antibody concentration 10ug/ml].)

Mouse anti-Human MCM3AP Monoclonal Antibody | anti-MCM3AP antibody

MCM3AP (80kD MCM3-associated Protein, Protein GANP, GANP, KIAA0572, MAP80, FLJ44336, FLJ45306) (HRP)

Gene Names
MCM3AP; GANP; SAC3; MAP80; PNRIID
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MCM3AP; Monoclonal Antibody; MCM3AP (80kD MCM3-associated Protein; Protein GANP; GANP; KIAA0572; MAP80; FLJ44336; FLJ45306) (HRP); anti-MCM3AP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes human MCM3AP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2539
Applicable Applications for anti-MCM3AP antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from MCM3AP (AAH13285) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MCM3AP is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MCM3AP is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MCM3AP antibody
MCM3AP is a 1980aa protein belonging to the SAC3 family and contains domains for MCM3-binding and RNA-primase activities. It is a potent natural inhibitor of the initiation of DNA replication whose action is mediated by interaction with MCM3. Interaction between MCM3 and MCM3AP is essential for nuclear localization and chromatin binding of MCM3AP. It limits DNA replication to once per cell cycle. MCM3AP is an acetyltransferase that acetylates MCM3. It also plays a role in B cell proliferation, differentiation and MCM3 nuclear localization. It is expressed mostly in germinal centers (GCs) of B cells.
Product Categories/Family for anti-MCM3AP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens minichromosome maintenance complex component 3 associated protein, mRNA
NCBI Official Synonym Full Names
minichromosome maintenance complex component 3 associated protein
NCBI Official Symbol
MCM3AP
NCBI Official Synonym Symbols
GANP; SAC3; MAP80; PNRIID
NCBI Protein Information
germinal-center associated nuclear protein

NCBI Description

The minichromosome maintenance protein 3 (MCM3) is one of the MCM proteins essential for the initiation of DNA replication. The protein encoded by this gene is a MCM3 binding protein. It was reported to have phosphorylation-dependent DNA-primase activity, which was up-regulated in antigen immunization induced germinal center. This protein was demonstrated to be an acetyltransferase that acetylates MCM3 and plays a role in DNA replication. The mutagenesis of a nuclear localization signal of MCM3 affects the binding of this protein with MCM3, suggesting that this protein may also facilitate MCM3 nuclear localization. This gene is expressed in the brain or in neuronal tissue. An allelic variant encoding amino acid Lys at 915, instead of conserved Glu, has been identified in patients with mild intellectual disability. [provided by RefSeq, Jan 2014]

Research Articles on MCM3AP

Similar Products

Product Notes

The MCM3AP (Catalog #AAA6153467) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCM3AP (80kD MCM3-associated Protein, Protein GANP, GANP, KIAA0572, MAP80, FLJ44336, FLJ45306) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCM3AP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCM3AP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCM3AP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.