Mouse anti-Human MCFD2 Monoclonal Antibody | anti-MCFD2 antibody

MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (HRP)

Cat. Num. AAA6153465

• Gene Names: MCFD2; F5F8D; SDNSF; F5F8D2; LMAN1IP
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MCFD2; Monoclonal Antibody; MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein; Multiple Coagulation Factor Deficiency Protein 2; SDNSF; DKFZp686G21263; F5F8D; F5F8D2; LMAN1IP) (HRP); anti-MCFD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A5-G4
• Specificity: Recognizes human MCFD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MCFD2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-147 from human MCFD2 (AAH40357) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.17kD).)

Western Blot (WB)

(Western Blot analysis of MCFD2 expression in transfected 293T cell line by MCFD2 monoclonal antibody. Lane 1: MCFD2 transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western blot analysis of MCFD2 over-expressed 293 cell line, cotransfected with MCFD2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MCFD2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-MCFD2 antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34193061
• NCBI GeneID: 90411
• Molecular Weight: 14,431 Da
• NCBI Official Full Name: Homo sapiens multiple coagulation factor deficiency 2, mRNA
• NCBI Official Synonym Full Names: multiple coagulation factor deficiency 2
• NCBI Official Symbol: MCFD2
• NCBI Official Synonym Symbols: F5F8D; SDNSF; F5F8D2; LMAN1IP
• NCBI Protein Information: multiple coagulation factor deficiency protein 2
• Protein Family: Multiple coagulation factor deficiency protein

NCBI Description

This gene encodes a soluble luminal protein with two calmodulin-like EF-hand motifs at its C-terminus. This protein forms a complex with LMAN1 (lectin mannose binding protein 1; also known as ERGIC-53) that facilitates the transport of coagulation factors V (FV) and VIII (FVIII) from the endoplasmic reticulum to the Golgi apparatus via an endoplasmic reticulum Golgi intermediate compartment (ERGIC). Mutations in this gene cause combined deficiency of FV and FVIII (F5F8D); a rare autosomal recessive bleeding disorder characterized by mild to moderate bleeding and coordinate reduction in plasma FV and FVIII levels. This protein has also been shown to maintain stem cell potential in adult central nervous system and is a marker for testicular germ cell tumors. The 3' UTR of this gene contains a transposon-like human repeat element named 'THE 1'. A processed RNA pseudogene of this gene is on chromosome 6p22.1. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2016]