Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MCAT Monoclonal Antibody | anti-MCAT antibody

MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (HRP)

Gene Names
MCAT; MT; MCT; MCT1; fabD; NET62; FASN2C
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MCAT; Monoclonal Antibody; MCAT (MT; Malonyl-CoA-acyl Carrier Protein Transacylase; Mitochondrial; Mitochondrial Malonyl CoA:ACP Acyltransferase; Mitochondrial Malonyltransferase; [Acyl-carrier-protein] Malonyltransferase) (HRP); anti-MCAT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F2
Specificity
Recognizes human MT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
390
Applicable Applications for anti-MCAT antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa291-391 from human MT (NP_775738) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MT monoclonal antibody. Western Blot analysis of MT expression in HeLa.)

Western Blot (WB) (MT monoclonal antibody. Western Blot analysis of MT expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MT on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MT on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MT is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MT is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-MCAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
malonyl-CoA-acyl carrier protein transacylase, mitochondrial isoform a
NCBI Official Synonym Full Names
malonyl-CoA-acyl carrier protein transacylase
NCBI Official Symbol
MCAT
NCBI Official Synonym Symbols
MT; MCT; MCT1; fabD; NET62; FASN2C
NCBI Protein Information
malonyl-CoA-acyl carrier protein transacylase, mitochondrial
UniProt Protein Name
Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
UniProt Gene Name
MCAT
UniProt Synonym Gene Names
MT; MCT
UniProt Entry Name
FABD_HUMAN

NCBI Description

The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2012]

Research Articles on MCAT

Similar Products

Product Notes

The MCAT mcat (Catalog #AAA6153618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCAT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCAT mcat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCAT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.