Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Mouse anti-Human MAPRE3 Monoclonal Antibody | anti-MAPRE3 antibody

MAPRE3 (Microtubule-associated Protein RP/EB Family Member 3, EB1 Protein Family Member 3, EBF3, End-binding Protein 3, EB3, RP3) (AP)

Gene Names
MAPRE3; EB3; RP3; EBF3; EBF3-S
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPRE3; Monoclonal Antibody; MAPRE3 (Microtubule-associated Protein RP/EB Family Member 3; EB1 Protein Family Member 3; EBF3; End-binding Protein 3; EB3; RP3) (AP); anti-MAPRE3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Specificity
Recognizes human MAPRE3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAPRE3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa125-219 from MAPRE3 (NP_036458) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDG*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged MAPRE3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAPRE3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MAPRE3 antibody
Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
Product Categories/Family for anti-MAPRE3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.1 kDa (301aa)) confirmed by MALDI-TOF
NCBI Official Full Name
microtubule-associated protein RP/EB family member 3
NCBI Official Synonym Full Names
microtubule associated protein RP/EB family member 3
NCBI Official Symbol
MAPRE3
NCBI Official Synonym Symbols
EB3; RP3; EBF3; EBF3-S
NCBI Protein Information
microtubule-associated protein RP/EB family member 3
UniProt Protein Name
Microtubule-associated protein RP/EB family member 3
UniProt Gene Name
MAPRE3
UniProt Synonym Gene Names
EBF3; EB3
UniProt Entry Name
MARE3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]

Uniprot Description

EB3: Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration. Belongs to the MAPRE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Microtubule-binding

Chromosomal Location of Human Ortholog: 2p23.3-p23.1

Cellular Component: microtubule cytoskeleton; cytoplasmic microtubule; perinuclear region of cytoplasm; cytoplasm; midbody

Molecular Function: protein binding; microtubule binding

Biological Process: mitosis; positive regulation of cyclin-dependent protein kinase activity; cell division; positive regulation of transcription, DNA-dependent

Research Articles on MAPRE3

Similar Products

Product Notes

The MAPRE3 mapre3 (Catalog #AAA6132221) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPRE3 (Microtubule-associated Protein RP/EB Family Member 3, EB1 Protein Family Member 3, EBF3, End-binding Protein 3, EB3, RP3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPRE3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPRE3 mapre3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPRE3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.