Mouse MAPKAPK2 Monoclonal Antibody | anti-MAPKAPK2 antibody

MAPKAPK2 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 2, MK2) (HRP)

Cat. Num. AAA6180415

• Gene Names: MAPKAPK2; MK2; MK-2; MAPKAP-K2
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: MAPKAPK2; Monoclonal Antibody; MAPKAPK2 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 2; MK2) (HRP); Mitogen-Activated Protein Kinase-Activated Protein Kinase 2; MK2; anti-MAPKAPK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B8
• Specificity: Recognizes MAPKAPK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MAPKAPK2 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAPKAPK2 (NP_116584, 266aa-352aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAPKAPK2 monoclonal antibody (M08), clone 3B8 Western Blot analysis of MAPKAPK2 expression in Jurkat (Cat # L017V1).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPKAPK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPKAPK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Western Blot (WB)

(MAPKAPK2 monoclonal antibody (M08), clone 3B8. Western Blot analysis of MAPKAPK2 expression in NIH/3T3.)

Western Blot (WB)

(MAPKAPK2 monoclonal antibody (M08), clone 3B8. Western Blot analysis of MAPKAPK2 expression in PC-12.)

Product Categories/Family for anti-MAPKAPK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 32481209
• NCBI GeneID: 9261
• NCBI Accession #: NP_116584
• NCBI GenBank Nucleotide #: NM_032960.3
• UniProt Accession #: P49137; Q5SY30; Q5SY41; Q8IYD6
• Molecular Weight: 42,203 Da
• NCBI Official Full Name: MAP kinase-activated protein kinase 2 isoform 2
• NCBI Official Synonym Full Names: mitogen-activated protein kinase-activated protein kinase 2
• NCBI Official Symbol: MAPKAPK2
• NCBI Official Synonym Symbols: MK2; MK-2; MAPKAP-K2
• NCBI Protein Information: MAP kinase-activated protein kinase 2
• UniProt Protein Name: MAP kinase-activated protein kinase 2
• UniProt Gene Name: MAPKAPK2
• UniProt Synonym Gene Names: MAPK-activated protein kinase 2; MAPKAP kinase 2; MAPKAP-K2; MAPKAPK-2; MK-2; MK2
• UniProt Entry Name: MAPK2_HUMAN

NCBI Description

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MAPKAPK2: a member of the MAPKAPK family of protein kinases. It is phosphorylated and activated by p38 in response to cytokines, stress and chemotactic factors.MAPKAPK-2 is apparently a direct target of p38 MAPK. HSP27 is one of its in vivo substrates. Two transcript variants encoding two different isoforms have been described.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); CAMK group; MAPKAPK family; MAPKAPK subfamily

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; centrosome; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; signal transducer activity; protein binding; ATP binding; protein kinase activity

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPK activity; stress-activated MAPK cascade; leukotriene metabolic process; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of interleukin-6 production; arachidonic acid metabolic process; response to stress; inflammatory response; inner ear development; toll-like receptor 4 signaling pathway; MyD88-independent toll-like receptor signaling pathway; MAPKKK cascade; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; peptidyl-serine phosphorylation; response to cytokine stimulus; Ras protein signal transduction; toll-like receptor signaling pathway; innate immune response; gene expression; regulation of tumor necrosis factor production; toll-like receptor 9 signaling pathway; G2/M transition DNA damage checkpoint; vascular endothelial growth factor receptor signaling pathway; response to DNA damage stimulus