Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody.)

Mouse MAPKAPK2 Monoclonal Antibody | anti-MAPKAPK2 antibody

MAPKAPK2 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 2, MK2) (PE)

Gene Names
MAPKAPK2; MK2; MK-2; MAPKAP-K2
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
MAPKAPK2; Monoclonal Antibody; MAPKAPK2 (Mitogen-Activated Protein Kinase-Activated Protein Kinase 2; MK2) (PE); Mitogen-Activated Protein Kinase-Activated Protein Kinase 2; MK2; anti-MAPKAPK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F9
Specificity
Recognizes MAPKAPK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MAPKAPK2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAPKAPK2 (NP_116584, 266aa-352aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MAPKAPK2 transfected lysate using anti-MAPKAPK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPKAPK2 MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPKAPK2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MAPKAPK2 antibody
This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-MAPKAPK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,203 Da
NCBI Official Full Name
MAP kinase-activated protein kinase 2 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 2
NCBI Official Symbol
MAPKAPK2
NCBI Official Synonym Symbols
MK2; MK-2; MAPKAP-K2
NCBI Protein Information
MAP kinase-activated protein kinase 2
UniProt Protein Name
MAP kinase-activated protein kinase 2
UniProt Gene Name
MAPKAPK2
UniProt Synonym Gene Names
MAPK-activated protein kinase 2; MAPKAP kinase 2; MAPKAP-K2; MAPKAPK-2; MK-2; MK2
UniProt Entry Name
MAPK2_HUMAN

NCBI Description

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MAPKAPK2: a member of the MAPKAPK family of protein kinases. It is phosphorylated and activated by p38 in response to cytokines, stress and chemotactic factors.MAPKAPK-2 is apparently a direct target of p38 MAPK. HSP27 is one of its in vivo substrates. Two transcript variants encoding two different isoforms have been described.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); CAMK group; MAPKAPK family; MAPKAPK subfamily

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; centrosome; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; signal transducer activity; protein binding; ATP binding; protein kinase activity

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPK activity; stress-activated MAPK cascade; leukotriene metabolic process; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of interleukin-6 production; arachidonic acid metabolic process; response to stress; inflammatory response; inner ear development; toll-like receptor 4 signaling pathway; MyD88-independent toll-like receptor signaling pathway; MAPKKK cascade; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; peptidyl-serine phosphorylation; response to cytokine stimulus; Ras protein signal transduction; toll-like receptor signaling pathway; innate immune response; gene expression; regulation of tumor necrosis factor production; toll-like receptor 9 signaling pathway; G2/M transition DNA damage checkpoint; vascular endothelial growth factor receptor signaling pathway; response to DNA damage stimulus

Research Articles on MAPKAPK2

Similar Products

Product Notes

The MAPKAPK2 mapkapk2 (Catalog #AAA6184692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAPKAPK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPKAPK2 mapkapk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPKAPK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.