Mouse anti-Human MAPK3 Monoclonal Antibody | anti-MAPK3 antibody

MAPK3 (Mitogen-activated Protein Kinase 3, MAPK 3, MAP Kinase 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase

Cat. Num. AAA6137514

• Gene Names: MAPK3; ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAPK3; Monoclonal Antibody; MAPK3 (Mitogen-activated Protein Kinase 3; MAPK 3; MAP Kinase 3; ERT2; Extracellular Signal-regulated Kinase 1; ERK1; ERK-1; Insulin-stimulated MAP2 Kinase; MAP Kinase Isoform p44; Microtubule-associated Protein 2 Kinase; Mitogen-activated Protein Kinase; anti-MAPK3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C9
• Specificity: Recognizes human MAPK3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1813

• Applicable Applications for anti-MAPK3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 25ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa279-379, from human MAPK3, (AAH13992) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MAPK3 monoclonal antibody Western Blot analysis of MAPK3 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody. Lane 1: MAPK3 transfected lysate (43.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell. [antibody concentration 25ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of MAPK3 transfected lysate using MAPK3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPK3 monoclonal antibody)

Testing Data

(Detection limit for recombinant GST tagged MAPK3 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-MAPK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 15559270
• NCBI GeneID: 5595
• NCBI Official Full Name: Homo sapiens mitogen-activated protein kinase 3, mRNA
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 3
• NCBI Official Symbol: MAPK3
• NCBI Official Synonym Symbols: ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
• NCBI Protein Information: mitogen-activated protein kinase 3

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq, Jul 2008]