Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (66.48kD).)

Mouse anti-Human MAPK12 Monoclonal Antibody | anti-MAPK12 antibody

MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3

Gene Names
MAPK12; ERK3; ERK6; ERK-6; SAPK3; PRKM12; SAPK-3; MAPK 12; P38GAMMA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPK12; Monoclonal Antibody; MAPK12 (Mitogen-activated Protein Kinase 12; MAPK 12; MAP Kinase 12; PRKM12; Extracellular Signal-regulated Kinase 6; ERK6; ERK-6; Mitogen-activated Protein Kinase p38 gamma; MAP Kinase p38 gamma; P38gamma; Stress-activated Protein Kinase 3; SAPK3; SAPK-3; anti-MAPK12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F4-3D2
Specificity
Recognizes human MAPK12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MAPK12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-368 from human MAPK12 (AAH15741) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (66.48kD).)

Western Blot (WB) (Western Blot detection against Immunogen (66.48kD).)

Western Blot (WB)

(Western Blot analysis of MAPK12 expression in transfected 293T cell line by MAPK12 monoclonal antibody. Lane 1: MAPK12 transfected lysate (41.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPK12 expression in transfected 293T cell line by MAPK12 monoclonal antibody. Lane 1: MAPK12 transfected lysate (41.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPK12 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPK12 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MAPK12 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAPK12 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-MAPK12 antibody
MAPK12, belongs to the MAP kinase family. MAPK12 functions as a signal transducer during differentiation of myoblasts to myotubes. Expressed in different areas throughout the body with common expression patterns in heart, p38 proteins use magnesium as a cofactor to catalyze the ATP-dependent phosphorylation of target proteins.
Product Categories/Family for anti-MAPK12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
40,808 Da
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase 12, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase 12
NCBI Official Symbol
MAPK12
NCBI Official Synonym Symbols
ERK3; ERK6; ERK-6; SAPK3; PRKM12; SAPK-3; MAPK 12; P38GAMMA
NCBI Protein Information
mitogen-activated protein kinase 12

NCBI Description

Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq, Jul 2008]

Research Articles on MAPK12

Similar Products

Product Notes

The MAPK12 (Catalog #AAA6153421) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.