Mouse MAP3K5 Monoclonal Antibody | anti-MAP3K5 antibody

MAP3K5 (Mitogen-Activated Protein Kinase Kinase Kinase 5, ASK1, MAPKKK5, MEKK5) (AP)

Cat. Num. AAA6162372

• Gene Names: MAP3K5; ASK1; MEKK5; MAPKKK5
• Applications: Western Blot
• Purity: Purified
• Synonyms: MAP3K5; Monoclonal Antibody; MAP3K5 (Mitogen-Activated Protein Kinase Kinase Kinase 5; ASK1; MAPKKK5; MEKK5) (AP); Mitogen-Activated Protein Kinase Kinase Kinase 5; MEKK5; anti-MAP3K5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1000
• Specificity: Recognizes MAP3K5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1374

• Applicable Applications for anti-MAP3K5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAP3K5 (AAH54503, 1231aa-1374aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MAP3K5 monoclonal antibody (M02), clone 1E3 Western Blot analysis of MAP3K5 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged MAP3K5 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-MAP3K5 antibody

Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK. [provided by RefSeq]

Product Categories/Family for anti-MAP3K5 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 32452016
• NCBI GeneID: 4217
• NCBI Official Full Name: Mitogen-activated protein kinase kinase kinase 5
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 5
• NCBI Official Symbol: MAP3K5
• NCBI Official Synonym Symbols: ASK1; MEKK5; MAPKKK5
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 5
• Protein Family: Mitogen-activated protein kinase kinase kinase

NCBI Description

Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK. [provided by RefSeq, Jul 2008]