Mouse MAP2K3 Monoclonal Antibody | anti-MAP2K3 antibody

MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3, MAPKK3, MEK3, MKK3, PRKMK3) (PE)

Cat. Num. AAA6184345

• Gene Names: MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• Applications: Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: MAP2K3; Monoclonal Antibody; MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3; MAPKK3; MEK3; MKK3; PRKMK3) (PE); Mitogen-Activated Protein Kinase Kinase 3; PRKMK3; anti-MAP2K3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D10
• Specificity: Recognizes MAP2K3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 347

• Applicable Applications for anti-MAP2K3 antibody: Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAP2K3 (AAH32478, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MAP2K3 on formalin-fixed paraffin-embedded human dysgerminoma. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAP2K3 on formalin-fixed paraffin-embedded human dysgerminoma. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP2K3 is approximately 0.03ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of MAP2K3 transfected lysate using anti-MAP2K3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAP2K3 monoclonal antibody.)

Western Blot (WB)

(Western Blot analysis of MAP2K3 expression in transfected 293T cell line by MAP2K3 monoclonal antibody (M02), clone 1D10.Lane 1: MAP2K3 transfected lysate (Predicted MW: 39.3 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-MAP2K3 antibody

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq]

Product Categories/Family for anti-MAP2K3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21619101
• NCBI GeneID: 5606
• NCBI Official Full Name: Mitogen-activated protein kinase kinase 3
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 3
• NCBI Official Symbol: MAP2K3
• NCBI Official Synonym Symbols: MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 3
• Protein Family: Dual specificity mitogen-activated protein kinase kinase

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]