Mouse anti-Human MAN2A1 Monoclonal Antibody | anti-MAN2A1 antibody

MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (AP)

Cat. Num. AAA6132191

• Gene Names: MAN2A1; MANA2; MANII; GOLIM7; AMan II
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAN2A1; Monoclonal Antibody; MAN2A1 (MANA2; Alpha-mannosidase 2; Golgi alpha-mannosidase II; Mannosidase alpha Class 2A Member 1; Mannosyl-oligosaccharide 1; 3-1; 6-alpha-mannosidase) (AP); anti-MAN2A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G9
• Specificity: Recognizes human MAN2A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1144

• Applicable Applications for anti-MAN2A1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1045-1144 from human MAN2A1 (NP_002363) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-MAN2A1 antibody

This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus.

Product Categories/Family for anti-MAN2A1 antibody

Antibodies; Enzymes; Glycosidase

References

1. Quantitative Proteomic Analysis of PCSK9 Gain of Function in Human Hepatic HuH7 Cells. Denis N, Palmer-Smith H, Elisma F, Busuttil A, Wright TG, Khalil MB, Prat A, Seidah NG, Chretien M, Mayne J, Figeys D.J Proteome Res. 2011 Mar 10.

NCBI and Uniprot Product Information

• NCBI GI #: 51477714
• NCBI GeneID: 4124
• NCBI Accession #: NP_002363
• NCBI GenBank Nucleotide #: NM_002372
• UniProt Accession #: Q16706
• NCBI Official Full Name: alpha-mannosidase 2
• NCBI Official Synonym Full Names: mannosidase alpha class 2A member 1
• NCBI Official Symbol: MAN2A1
• NCBI Official Synonym Symbols: MANA2; MANII; GOLIM7; AMan II
• NCBI Protein Information: alpha-mannosidase 2
• UniProt Protein Name: Alpha-mannosidase 2
• UniProt Gene Name: MAN2A1
• UniProt Synonym Gene Names: MANA2; AMan II; Man II
• UniProt Entry Name: MA2A1_HUMAN

NCBI Description

This gene encodes a glycosyl hydrolase that localizes to the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus. [provided by RefSeq, Dec 2013]

Uniprot Description

MAN2A1: Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway. Belongs to the glycosyl hydrolase 38 family.

Protein type: Glycan Metabolism - N-glycan biosynthesis; Membrane protein, integral; EC 3.2.1.114; Hydrolase

Chromosomal Location of Human Ortholog: 5q21.3

Cellular Component: Golgi membrane; cis-Golgi network; membrane; integral to membrane

Molecular Function: hydrolase activity, hydrolyzing N-glycosyl compounds; zinc ion binding; mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity; carbohydrate binding

Biological Process: mannose metabolic process; mitochondrion organization and biogenesis; positive regulation of neurogenesis; cellular protein metabolic process; in utero embryonic development; protein amino acid N-linked glycosylation via asparagine; respiratory gaseous exchange; N-glycan processing; liver development; post-translational protein modification; alveolus development; retina morphogenesis in camera-type eye; vacuole organization and biogenesis