Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.55kD).)

Mouse anti-Human MAGEA3 Monoclonal Antibody | anti-MAGEA3 antibody

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (Biotin)

Gene Names
MAGEA3; HIP8; HYPD; CT1.3; MAGE3; MAGEA6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGEA3; Monoclonal Antibody; MAGEA3 (Melanoma-associated Antigen 3; Antigen MZ2-D; Cancer/Testis Antigen 1.3; CT1.3; MAGE-3 Antigen; MAGE3; MGC14613) (Biotin); anti-MAGEA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D10
Specificity
Recognizes human MAGEA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MAGEA3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa44-114 from human MAGEA3 (NP_005353) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.55kD).)

Testing Data

(Detection limit for recombinant GST tagged MAGEA3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAGEA3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-MAGEA3 antibody
MAGEA3 is a member of the MAGEA gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 80% sequence identity between each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are expressed at a high level in a number of tumors of various histologic types, and are silent in normal tissues with the exception of testis and placenta. The MAGEA genes are clustered on chromosome Xq28. They may be implicated in some hereditary disorders, such as dyskeratosis congenita.
Product Categories/Family for anti-MAGEA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.1 kDa (337aa) confirmed by MALDI-TOF
NCBI Official Full Name
melanoma-associated antigen 3
NCBI Official Synonym Full Names
MAGE family member A3
NCBI Official Symbol
MAGEA3
NCBI Official Synonym Symbols
HIP8; HYPD; CT1.3; MAGE3; MAGEA6
NCBI Protein Information
melanoma-associated antigen 3
UniProt Protein Name
Melanoma-associated antigen 3
UniProt Gene Name
MAGEA3
UniProt Synonym Gene Names
MAGE3; CT1.3
UniProt Entry Name
MAGA3_HUMAN

NCBI Description

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]

Uniprot Description

MAGEA3: Proposed to enhance ubiquitin ligase activity of RING- type zinc finger-containing E3 ubiquitin-protein ligases. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq28

Molecular Function: protein binding

Research Articles on MAGEA3

Similar Products

Product Notes

The MAGEA3 magea3 (Catalog #AAA6142786) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEA3 magea3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.