Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is 1ng/ml using 129297 as a capture antibody.)

Mouse anti-Human MAFA Monoclonal Antibody | anti-MAFA antibody

MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A) (Biotin)

Gene Names
MAFA; INSDM; hMafA; RIPE3b1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAFA; Monoclonal Antibody; MAFA (Transcription Factor MafA; Pancreatic beta-cell-specific Transcriptional Activator; Transcription Factor RIPE3b1; V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A) (Biotin); anti-MAFA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F1
Specificity
Recognizes human MAFA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MAFA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa222-308 of human MAFA with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is 1ng/ml using 129297 as a capture antibody.)

Testing Data (Detection limit is 1ng/ml using 129297 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against immunogen using 129297 (35.68kD).)

Western Blot (WB) (Western Blot detection against immunogen using 129297 (35.68kD).)
Related Product Information for anti-MAFA antibody
MafA is a 352aa containing transcription factor playing an important part in the regulation of the insulin gene transcription. It belongs to the bZIP family and Maf subfamily with a bZIP domain and binds DNA as a homodimer. Transcription factor MafA binds to RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene. MafA is known to cooperate synergistically with NEUROD1 and PDX1 and is known to be up-regulated by glucose. It is detected in nuclei of pancreas islet beta cells.
Product Categories/Family for anti-MAFA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
transcription factor MafA
NCBI Official Synonym Full Names
MAF bZIP transcription factor A
NCBI Official Symbol
MAFA
NCBI Official Synonym Symbols
INSDM; hMafA; RIPE3b1
NCBI Protein Information
transcription factor MafA
UniProt Protein Name
Transcription factor MafA
Protein Family
UniProt Gene Name
MAFA
UniProt Entry Name
MAFA_HUMAN

NCBI Description

MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al., 2002 [PubMed 12011435]).[supplied by OMIM, Mar 2008]

Uniprot Description

MAFA: Acts as a transcriptional factor. Specifically binds the insulin enhancer element RIPE3b and activates insulin gene expression. Cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds DNA as a homodimer (Probable). Interacts with NEUROD1, PCAF and PDX1. Up-regulated by glucose. Belongs to the bZIP family. Maf subfamily.

Protein type: Transcription factor; DNA-binding; Tumor suppressor; Oncoprotein

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: nucleus

Molecular Function: DNA binding; protein heterodimerization activity; protein homodimerization activity; transcription factor activity

Biological Process: insulin secretion; nitric oxide mediated signal transduction; positive regulation of transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; response to glucose stimulus; transcription from RNA polymerase II promoter

Research Articles on MAFA

Similar Products

Product Notes

The MAFA mafa (Catalog #AAA6142781) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAFA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAFA mafa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAFA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.