Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAF monoclonal antibody (M02), clone 6B8. Western Blot analysis of MAF expression in PC-12 (Cat # L012V1).)

Mouse MAF Monoclonal Antibody | anti-MAF antibody

MAF (V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (avian), MGC71685, c-MAF) (FITC)

Gene Names
MAF; CCA4; AYGRP; c-MAF; CTRCT21
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MAF; Monoclonal Antibody; MAF (V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (avian); MGC71685; c-MAF) (FITC); V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (avian); c-MAF; anti-MAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6B8
Specificity
Recognizes MAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MAF antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAF (NP_005351, 304aa-403aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAF monoclonal antibody (M02), clone 6B8. Western Blot analysis of MAF expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (MAF monoclonal antibody (M02), clone 6B8. Western Blot analysis of MAF expression in PC-12 (Cat # L012V1).)
Related Product Information for anti-MAF antibody
Mouse monoclonal antibody raised against a partial recombinant MAF.
Product Categories/Family for anti-MAF antibody
References
1. TACI expression is associated with a mature bone marrow plasma cell signature and C-MAF overexpression in human myeloma cell lines.Moreaux J, Hose D, Jourdan M, Reme T, Hundemer M, Moos M, Robert N, Moine P, De Vos J, Goldschmidt H, Klein B.Haematologica. 2007 Jun;92(6):803-11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
transcription factor Maf isoform b
NCBI Official Synonym Full Names
MAF bZIP transcription factor
NCBI Official Symbol
MAF
NCBI Official Synonym Symbols
CCA4; AYGRP; c-MAF; CTRCT21
NCBI Protein Information
transcription factor Maf
UniProt Protein Name
Transcription factor Maf
Protein Family
UniProt Gene Name
MAF
UniProt Entry Name
MAF_HUMAN

NCBI Description

The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

MAF: Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells. When overexpressed, represses anti-oxidant response element (ARE)- mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters. Homodimer or heterodimer with other bHLH-Zip transcription factors. Binds DNA as a homodimer or as a heterodimer. Heterotetramer of two MAF and two USF2. Interacts with PAX6; the interaction is direct. Interacts with MYB; interaction takes place weakly in normal T-cells and increases in T-cells following stimulation through the TCR engagement. Interacts with MYB; the ternary complex formed with MYB and the CD13 promoter is regulated in response to differentiating signals. Interacts with USF2; the interaction inhibits its DNA-binding activity on the L7 promoter. Interacts with CREBBP, EP300 and ETS1. Up-regulated with tert-butyl hydroquinone (t-BHQ). Expressed in endothelial cells. Belongs to the bZIP family. Maf subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Tumor suppressor; Transcription factor; Cell development/differentiation; Oncoprotein

Chromosomal Location of Human Ortholog: 16q22-q23

Cellular Component: cytoplasm; chromatin; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: transcription from RNA polymerase II promoter; cytokine production; positive regulation of transcription from RNA polymerase II promoter; regulation of chondrocyte differentiation; negative regulation of transcription from RNA polymerase II promoter; inner ear development; cell development

Disease: Cataract 21, Multiple Types; Ayme-gripp Syndrome

Research Articles on MAF

Similar Products

Product Notes

The MAF maf (Catalog #AAA6176948) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAF maf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.