Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Mouse anti-Human LSM6 Monoclonal Antibody | anti-LSM6 antibody

LSM6 (U6 snRNA-associated Sm-like Protein LSm6) (AP)

Gene Names
LSM6; YDR378C
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LSM6; Monoclonal Antibody; LSM6 (U6 snRNA-associated Sm-like Protein LSm6) (AP); anti-LSM6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B5-1B10
Specificity
Recognizes human LSM6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LSM6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-81 from LSM6 (AAH16026) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.91kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.91kD).)

Western Blot (WB)

(Western Blot analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody. Lane 1: LSM6 transfected lysate (9.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody. Lane 1: LSM6 transfected lysate (9.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LSM6 antibody
Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 di-snRNP, spliceosomal U4/U6.U5 tri-snRNP, and free U6 snRNP). It binds directly to the 3'-terminal U-tract of U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. LSM2-LSM8 probably also is involved degradation of nuclear pre-mRNA by targeting them for decapping, and in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA.
Product Categories/Family for anti-LSM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
9,128 Da
NCBI Official Full Name
Homo sapiens LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
NCBI Official Symbol
LSM6
NCBI Official Synonym Symbols
YDR378C
NCBI Protein Information
U6 snRNA-associated Sm-like protein LSm6; Sm protein F
UniProt Protein Name
U6 snRNA-associated Sm-like protein LSm6
UniProt Gene Name
LSM6
UniProt Entry Name
LSM6_HUMAN

Similar Products

Product Notes

The LSM6 lsm6 (Catalog #AAA6132157) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LSM6 (U6 snRNA-associated Sm-like Protein LSm6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSM6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LSM6 lsm6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LSM6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.