Testing Data
(Detection limit for recombinant GST tagged LONRF2 is 0.3ng/ml as a capture antibody)
Mouse anti-Human LONRF2 Monoclonal Antibody | anti-LONRF2 antibody
LONRF2 (LON Peptidase N-terminal Domain and RING Finger Protein 2, Neuroblastoma Apoptosis-related Protease, RING Finger Protein 192, RNF192, FLJ45273, MGC126711, MGC126713) (HRP)
Gene Names
LONRF2; RNF192
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LONRF2; Monoclonal Antibody; LONRF2 (LON Peptidase N-terminal Domain and RING Finger Protein 2; Neuroblastoma Apoptosis-related Protease; RING Finger Protein 192; RNF192; FLJ45273; MGC126711; MGC126713) (HRP); anti-LONRF2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C7
Specificity
Recognizes human LONRF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-LONRF2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-109 from human LONRF2 (NP_940863) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged LONRF2 is 0.3ng/ml as a capture antibody)
Testing Data
(Detection limit for recombinant GST tagged LONRF2 is 0.3ng/ml as a capture antibody)
Product Categories/Family for anti-LONRF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
LON peptidase N-terminal domain and RING finger protein 2
NCBI Official Synonym Full Names
LON peptidase N-terminal domain and ring finger 2
NCBI Official Symbol
LONRF2
NCBI Official Synonym Symbols
RNF192
NCBI Protein Information
LON peptidase N-terminal domain and RING finger protein 2
UniProt Protein Name
LON peptidase N-terminal domain and RING finger protein 2
Protein Family
UniProt Gene Name
LONRF2
UniProt Synonym Gene Names
RNF192
UniProt Entry Name
LONF2_HUMAN
Uniprot Description
Sequence similarities: Contains 1 Lon domain.Contains 1 RING-type zinc finger.Contains 6 TPR repeats.
Research Articles on LONRF2
Similar Products
Product Notes
The LONRF2 lonrf2 (Catalog #AAA6153345) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LONRF2 (LON Peptidase N-terminal Domain and RING Finger Protein 2, Neuroblastoma Apoptosis-related Protease, RING Finger Protein 192, RNF192, FLJ45273, MGC126711, MGC126713) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LONRF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LONRF2 lonrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LONRF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
