<
Testing Data
(Immunoperoxidase of monoclonal antibody to LMO4 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Mouse LMO4 Monoclonal Antibody | anti-LMO4 antibody
LMO4 (LIM Domain only 4) (PE)
Applications
Immunofluorescence, Immunohistochemistry
Purity
Purified
Synonyms
LMO4; Monoclonal Antibody; LMO4 (LIM Domain only 4) (PE); LIM Domain only 4; anti-LMO4 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B6
Specificity
Recognizes LMO4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
165
Applicable Applications for anti-LMO4 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LMO4 (AAH17673, 1aa-165aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Immunoperoxidase of monoclonal antibody to LMO4 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Testing Data
(Immunoperoxidase of monoclonal antibody to LMO4 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to LMO4 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to LMO4 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Testing Data
(Detection limit for recombinant GST tagged LMO4 is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged LMO4 is 0.3 ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LMO4 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LMO4 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LMO4 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LMO4 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-LMO4 antibody
This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq]
Product Categories/Family for anti-LMO4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
LIM domain only 4
Protein Family
Similar Products
Product Notes
The LMO4 (Catalog #AAA6183855) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LMO4 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMO4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMO4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
