Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LMBR1 Monoclonal Antibody | anti-LMBR1 antibody

LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) (MaxLight 750)

Gene Names
LMBR1; LSS; TPT; ZRS; ACHP; PPD2; THYP; DIF14; C7orf2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMBR1; Monoclonal Antibody; LMBR1 (Limb Region 1 Protein Homolog; Differentiation-related Gene 14 Protein; C7orf2; DIF14; ACHP; FLJ11665; PPD2; TPT) (MaxLight 750); anti-LMBR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Specificity
Recognizes human LMBR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-LMBR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa214-296 from human LMBR1 (NP_071903) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-LMBR1 antibody
Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV).
Product Categories/Family for anti-LMBR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
limb region 1 protein homolog isoform b
NCBI Official Synonym Full Names
limb development membrane protein 1
NCBI Official Symbol
LMBR1
NCBI Official Synonym Symbols
LSS; TPT; ZRS; ACHP; PPD2; THYP; DIF14; C7orf2
NCBI Protein Information
limb region 1 protein homolog
UniProt Protein Name
Limb region 1 protein homolog
Protein Family
UniProt Gene Name
LMBR1
UniProt Synonym Gene Names
C7orf2; DIF14
UniProt Entry Name
LMBR1_HUMAN

NCBI Description

This gene encodes a member of the LMBR1-like membrane protein family. Another member of this protein family has been shown to be a lipocalin transmembrane receptor. A highly conserved, cis-acting regulatory module for the sonic hedgehog gene is located within an intron of this gene. Consequently, disruption of this genic region can alter sonic hedgehog expression and affect limb patterning, but it is not known if this gene functions directly in limb development. Mutations and chromosomal deletions and rearrangements in this genic region are associated with acheiropody and preaxial polydactyly, which likely result from altered sonic hedgehog expression. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Putative membrane receptor.

Subcellular location: Membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Widely expressed with strongest expression in heart and pancreas. Ref.8

Involvement in disease: Preaxial polydactyly 2 (PPD2) [MIM:174500]: Polydactyly consists of duplication of the distal phalanx. The thumb in PPD2 is usually opposable and possesses a normal metacarpal.Note: The disease is caused by mutations affecting the gene represented in this entry. Disease-causing mutations are located in intron 5 of LMBR1. The mutations do not alter normal LMBR1 expression and function, but disrupt a long-range, cis-regulatory element of SHH expression contained in LMBR1 intron 5 (Ref.10). Ref.10Acheiropody (ACHP) [MIM:200500]: Very rare condition characterized by bilateral congenital amputations of the hands and feet. The specific malformative phenotype consists of a complete amputation of the distal epiphysis of the humerus, amputation of the tibial diaphysis and aplasia of the radius, ulna, fibula and of all the bones of the hands and feet.Note: The disease is caused by mutations affecting the gene represented in this entry.Syndactyly 4 (SDTY4) [MIM:186200]: A form of syndactyly, a congenital anomaly of the hand or foot marked by persistence of the webbing between adjacent digits that are more or less completely attached. SDTY4 is characterized by complete bilateral syndactyly (involving all digits 1 to 5). A frequent association with polydactyly (with six metacarpals and six digits) has been reported. Feet are affected occasionally.Note: The disease is caused by mutations affecting the gene represented in this entry. Disease-causing mutations are located in intron 5 of LMBR1. The mutations do not alter normal LMBR1 expression and function, but disrupt a long-range, cis-regulatory element of SHH expression contained in LMBR1 intron 5. Ref.11

Sequence similarities: Belongs to the LIMR family.

Sequence caution: The sequence AAD43188.1 differs from that shown. Reason: Erroneous initiation. The sequence AAK31345.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15595.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on LMBR1

Similar Products

Product Notes

The LMBR1 lmbr1 (Catalog #AAA6233678) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMBR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMBR1 lmbr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMBR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.