Mouse LHX9 Monoclonal Antibody | anti-LHX9 antibody

LHX9 (LIM Homeobox 9) (Biotin)

Cat. Num. AAA6174260

• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: LHX9; Monoclonal Antibody; LHX9 (LIM Homeobox 9) (Biotin); LIM Homeobox 9; anti-LHX9 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1D8
• Specificity: Recognizes LHX9.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-LHX9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LHX9 (NP_001014434.1, 291aa-388aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LHX9 expression in transfected 293T cell line by LHX9 monoclonal antibody (M08), clone 1D8.Lane 1: LHX9 transfected lysate (Predicted MW: 44 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-LHX9 antibody

This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Product Categories/Family for anti-LHX9 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 62241033
• NCBI GeneID: 56956
• NCBI Accession #: NP_001014434.1
• NCBI GenBank Nucleotide #: NM_001014434.1
• UniProt Accession #: Q9NQ69; Q5VUE2; Q5VUE3; Q5VUE6; Q86UH2; Q9BYU6; Q9NQ70
• Molecular Weight: 43,976 Da
• NCBI Official Full Name: LIM/homeobox protein Lhx9 isoform 2
• NCBI Official Synonym Full Names: LIM homeobox 9
• NCBI Official Symbol: LHX9
• NCBI Protein Information: LIM/homeobox protein Lhx9; LIM homeobox protein 9
• UniProt Protein Name: LIM/homeobox protein Lhx9
• Protein Family: LIM/homeobox protein
• UniProt Gene Name: LHX9
• UniProt Synonym Gene Names: LIM homeobox protein 9
• UniProt Entry Name: LHX9_HUMAN

NCBI Description

This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

LHX9: Involved in gonadal development. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q31.1

Cellular Component: nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding; transcription corepressor activity

Biological Process: cell proliferation; male gonad development; gonad morphogenesis; motor axon guidance; negative regulation of transcription, DNA-dependent; female gonad development