Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LHX6 monoclonal antibody (M06), clone 2A2 Western Blot analysis of LHX6 expression in Hela S3 NE (Cat # L013V3).)

Mouse LHX6 Monoclonal Antibody | anti-LHX6 antibody

LHX6 (LIM Homeobox 6, LHX6.1, MGC119542, MGC119544, MGC119545) (PE)

Gene Names
LHX6; LHX6.1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LHX6; Monoclonal Antibody; LHX6 (LIM Homeobox 6; LHX6.1; MGC119542; MGC119544; MGC119545) (PE); LIM Homeobox 6; MGC119545; anti-LHX6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A2
Specificity
Recognizes LHX6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LHX6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LHX6 (NP_055183, 274aa-363aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LHX6 monoclonal antibody (M06), clone 2A2 Western Blot analysis of LHX6 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (LHX6 monoclonal antibody (M06), clone 2A2 Western Blot analysis of LHX6 expression in Hela S3 NE (Cat # L013V3).)
Related Product Information for anti-LHX6 antibody
This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq]
Product Categories/Family for anti-LHX6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
LIM/homeobox protein Lhx6 isoform 1
NCBI Official Synonym Full Names
LIM homeobox 6
NCBI Official Symbol
LHX6
NCBI Official Synonym Symbols
LHX6.1
NCBI Protein Information
LIM/homeobox protein Lhx6
UniProt Protein Name
LIM/homeobox protein Lhx6
Protein Family
UniProt Gene Name
LHX6
UniProt Synonym Gene Names
LHX6.1; LIM homeobox protein 6
UniProt Entry Name
LHX6_HUMAN

NCBI Description

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor involved in embryogenesis and head development and is highly expressed in neural crest derived mesenchyme cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2017]

Uniprot Description

LHX6: Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 9q33.2

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity; zinc ion binding

Biological Process: cell maturation; cerebral cortex GABAergic interneuron migration; cerebral cortex radially oriented cell migration; cerebral cortex tangential migration; forebrain neuron fate commitment; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on LHX6

Similar Products

Product Notes

The LHX6 lhx6 (Catalog #AAA6184142) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LHX6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LHX6 lhx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LHX6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.