Mouse LGALS3 Monoclonal Antibody | anti-LGALS3 antibody

LGALS3 (Lectin, Galactoside-Binding, Soluble, 3, CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2) (Biotin)

Cat. Num. AAA6174406

• Gene Names: LGALS3; L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: LGALS3; Monoclonal Antibody; LGALS3 (Lectin; Galactoside-Binding; Soluble; 3; CBP35; GAL3; GALBP; GALIG; LGALS2; MAC2) (Biotin); Lectin; MAC2; anti-LGALS3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G8
• Specificity: Recognizes LGALS3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 250

• Applicable Applications for anti-LGALS3 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LGALS3 (AAH01120, 1aa-250aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LGALS3 monoclonal antibody (M03), clone 3G8. Western Blot analysis of LGALS3 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged LGALS3 is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of LGALS3 expression in transfected 293T cell line by LGALS3 monoclonal antibody (M03), clone 3G8.Lane 1: LGALS3 transfected lysate (Predicted MW: 26.2 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LGALS3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LGALS3 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-LGALS3 antibody

Mouse monoclonal antibody raised against a full-length recombinant LGALS3.

Product Categories/Family for anti-LGALS3 antibody

Antibodies; Lectins

NCBI and Uniprot Product Information

• NCBI GI #: 12654571
• NCBI GeneID: 3958
• NCBI Official Full Name: Lectin, galactoside-binding, soluble, 3
• NCBI Official Synonym Full Names: galectin 3
• NCBI Official Symbol: LGALS3
• NCBI Official Synonym Symbols: L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
• NCBI Protein Information: galectin-3

NCBI Description

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]