Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human LEPR Monoclonal Antibody | anti-LEPR antibody

LEPR (DB, OBR, Leptin Receptor, LEP-R, HuB219, OB Receptor, OB-R, CD295) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LEPR; Monoclonal Antibody; LEPR (DB; OBR; Leptin Receptor; LEP-R; HuB219; OB Receptor; OB-R; CD295) (FITC); anti-LEPR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H5
Specificity
Recognizes human LEPR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
896
Applicable Applications for anti-LEPR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-130 from human LEPR (NP_001003679) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged LEPR is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LEPR is 1ng/ml as a capture antibody.)
Related Product Information for anti-LEPR antibody
Receptor for obesity factor (leptin). On ligand binding, mediates signaling through JAK2/STAT3. Involved in the regulation of fat metabolism and, in a hematopoietic pathway, required for normal lymphopoiesis. May play a role in reproduction. Can also mediate the ERK/FOS signaling pathway.
Product Categories/Family for anti-LEPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leptin receptor isoform 3
UniProt Protein Name
Leptin receptor
Protein Family
UniProt Gene Name
LEPR
UniProt Synonym Gene Names
DB; OBR; LEP-R; OB-R
UniProt Entry Name
LEPR_HUMAN

Uniprot Description

LEPR: the receptor for leptin (obesity factor). A single-transmembrane-domain receptor of the cytokine receptor family. On ligand binding, mediates signaling through JAK2/STAT3. Involved in the regulation of fat metabolism and, in a hematopoietic pathway, required for normal lymphopoiesis. May play a role in reproduction. Five alternatively spliced transcript variants have been reported.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: integral to membrane; plasma membrane; extracellular region; receptor complex

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; identical protein binding; protein binding; transmembrane receptor activity

Biological Process: cholesterol metabolic process; cell surface receptor linked signal transduction; negative regulation of hydrolase activity; multicellular organismal development; negative regulation of gluconeogenesis; cytokine and chemokine mediated signaling pathway; energy reserve metabolic process

Disease: Leptin Receptor Deficiency

Similar Products

Product Notes

The LEPR lepr (Catalog #AAA6147996) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LEPR (DB, OBR, Leptin Receptor, LEP-R, HuB219, OB Receptor, OB-R, CD295) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LEPR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LEPR lepr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LEPR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.