Mouse LEF1 Monoclonal Antibody | anti-LEF1 antibody

LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (AP)

Cat. Num. AAA6162152

• Gene Names: LEF1; LEF-1; TCF10; TCF7L3; TCF1ALPHA
• Applications: Western Blot
• Purity: Purified
• Synonyms: LEF1; Monoclonal Antibody; LEF1 (Lymphoid Enhancer-Binding Factor 1; DKFZp586H0919; TCF1ALPHA) (AP); Lymphoid Enhancer-Binding Factor 1; TCF1ALPHA; anti-LEF1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H3
• Specificity: Recognizes LEF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-LEF1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LEF1 (NP_057353, 14aa-123aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LEF1 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-LEF1 antibody

LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]). [supplied by OMIM]

Product Categories/Family for anti-LEF1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 7705917
• NCBI GeneID: 51176
• NCBI Accession #: NP_057353
• NCBI GenBank Nucleotide #: NM_016269
• UniProt Accession #: Q9UJU2
• Molecular Weight: 44kDa
• NCBI Official Full Name: lymphoid enhancer-binding factor 1 isoform 1
• NCBI Official Synonym Full Names: lymphoid enhancer binding factor 1
• NCBI Official Symbol: LEF1
• NCBI Official Synonym Symbols: LEF-1; TCF10; TCF7L3; TCF1ALPHA
• NCBI Protein Information: lymphoid enhancer-binding factor 1
• UniProt Protein Name: Lymphoid enhancer-binding factor 1
• Protein Family: Lymphoid enhancer-binding factor
• UniProt Gene Name: LEF1
• UniProt Synonym Gene Names: LEF-1; TCF1-alpha
• UniProt Entry Name: LEF1_HUMAN

NCBI Description

This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

LEF-1: a transcription factor of the TCF/LEF family. Participates in the Wnt signaling pathway and regulates T-cell receptor alpha-C enhancer function. Activates transcription of target genes in the presence of CTNNB1 and EP300. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1. Deletions in LEF1 have been observed in a subset of pre-B-cell acute lymphoblastic leukemia (B-ALL) cases. Four human isoforms produced by alternative promoter usage and alternative splicing have been described. Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 4q23-q25

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; estrogen receptor activity; DNA binding; histone binding; sequence-specific DNA binding; gamma-catenin binding; caspase inhibitor activity; beta-catenin binding; estrogen receptor binding; chromatin binding; transcription factor binding; DNA bending activity; transcription factor activity

Biological Process: radial glial cell differentiation in the forebrain; hypothalamus development; positive regulation of transcription, DNA-dependent; T-helper 1 cell differentiation; Wnt receptor signaling pathway through beta-catenin; forebrain neuroblast division; forebrain neuron differentiation; BMP signaling pathway; negative regulation of interleukin-13 production; neural crest cell migration; regulation of striated muscle development; embryonic limb morphogenesis; somitogenesis; dentate gyrus development; sensory perception of taste; negative regulation of striated muscle development; positive regulation of cell growth; patterning of blood vessels; negative regulation of interleukin-5 production; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis; transcription from RNA polymerase II promoter; B cell proliferation; negative regulation of interleukin-4 production; tongue development; paraxial mesoderm formation; positive regulation of granulocyte differentiation; alpha-beta T cell differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of caspase activity; anatomical structure regression; regulation of cell-cell adhesion; mammary gland development; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; muscle fiber development; Wnt receptor signaling pathway; neutrophil differentiation; negative regulation of DNA binding; odontogenesis of dentine-containing teeth; osteoblast differentiation; formation of radial glial scaffolds; T cell receptor V(D)J recombination; epithelial to mesenchymal transition; negative regulation of cell-cell adhesion; sprouting angiogenesis; eye pigmentation; positive regulation of cell migration