Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged LEF1 is approximately 1ng/ml as a capture antibody.)

Mouse LEF1 Monoclonal Antibody | anti-LEF1 antibody

LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (FITC)

Gene Names
LEF1; LEF-1; TCF10; TCF7L3; TCF1ALPHA
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
LEF1; Monoclonal Antibody; LEF1 (Lymphoid Enhancer-Binding Factor 1; DKFZp586H0919; TCF1ALPHA) (FITC); Lymphoid Enhancer-Binding Factor 1; TCF1ALPHA; anti-LEF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes LEF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LEF1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LEF1 (NP_057353, 33aa-138aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LEF1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LEF1 is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LEF1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LEF1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LEF1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LEF1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-LEF1 antibody
LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]). [supplied by OMIM]
Product Categories/Family for anti-LEF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
lymphoid enhancer-binding factor 1 isoform 1
NCBI Official Synonym Full Names
lymphoid enhancer binding factor 1
NCBI Official Symbol
LEF1
NCBI Official Synonym Symbols
LEF-1; TCF10; TCF7L3; TCF1ALPHA
NCBI Protein Information
lymphoid enhancer-binding factor 1
UniProt Protein Name
Lymphoid enhancer-binding factor 1
UniProt Gene Name
LEF1
UniProt Synonym Gene Names
LEF-1; TCF1-alpha
UniProt Entry Name
LEF1_HUMAN

NCBI Description

This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

LEF-1: a transcription factor of the TCF/LEF family. Participates in the Wnt signaling pathway and regulates T-cell receptor alpha-C enhancer function. Activates transcription of target genes in the presence of CTNNB1 and EP300. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1. Deletions in LEF1 have been observed in a subset of pre-B-cell acute lymphoblastic leukemia (B-ALL) cases. Four human isoforms produced by alternative promoter usage and alternative splicing have been described. Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 4q23-q25

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; estrogen receptor activity; DNA binding; histone binding; sequence-specific DNA binding; gamma-catenin binding; caspase inhibitor activity; beta-catenin binding; estrogen receptor binding; chromatin binding; transcription factor binding; DNA bending activity; transcription factor activity

Biological Process: radial glial cell differentiation in the forebrain; hypothalamus development; positive regulation of transcription, DNA-dependent; T-helper 1 cell differentiation; Wnt receptor signaling pathway through beta-catenin; forebrain neuroblast division; forebrain neuron differentiation; BMP signaling pathway; negative regulation of interleukin-13 production; neural crest cell migration; regulation of striated muscle development; embryonic limb morphogenesis; somitogenesis; dentate gyrus development; sensory perception of taste; negative regulation of striated muscle development; positive regulation of cell growth; patterning of blood vessels; negative regulation of interleukin-5 production; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis; transcription from RNA polymerase II promoter; B cell proliferation; negative regulation of interleukin-4 production; tongue development; paraxial mesoderm formation; positive regulation of granulocyte differentiation; alpha-beta T cell differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of caspase activity; anatomical structure regression; regulation of cell-cell adhesion; mammary gland development; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; muscle fiber development; Wnt receptor signaling pathway; neutrophil differentiation; negative regulation of DNA binding; odontogenesis of dentine-containing teeth; osteoblast differentiation; formation of radial glial scaffolds; T cell receptor V(D)J recombination; epithelial to mesenchymal transition; negative regulation of cell-cell adhesion; sprouting angiogenesis; eye pigmentation; positive regulation of cell migration

Research Articles on LEF1

Similar Products

Product Notes

The LEF1 lef1 (Catalog #AAA6175858) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LEF1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LEF1 lef1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LEF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.