Mouse LDLR Monoclonal Antibody | anti-LDLR antibody

LDLR (Low Density Lipoprotein Receptor, FH, FHC) (PE)

Cat. Num. AAA6186141

• Gene Names: LDLR; FH; FHC; LDLCQ2
• Applications: Western Blot
• Purity: Purified
• Synonyms: LDLR; Monoclonal Antibody; LDLR (Low Density Lipoprotein Receptor; FH; FHC) (PE); Low Density Lipoprotein Receptor; FHC; anti-LDLR antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5000000
• Specificity: Recognizes LDLR.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LDLR antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LDLR (NP_000518, 105aa-205aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged LDLR is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-LDLR antibody

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. [provided by RefSeq]

Product Categories/Family for anti-LDLR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4504975
• NCBI GeneID: 3949
• NCBI Accession #: NP_000518
• NCBI GenBank Nucleotide #: NM_000527.4
• UniProt Accession #: P01130; Q53ZD9; Q59FQ1; Q9UDH7; B4DII3; B4DJZ8; B4DR00; B4DTQ3; C0JYY8; H0YLU8; H0YNT7
• Molecular Weight: 82,255 Da
• NCBI Official Full Name: low-density lipoprotein receptor isoform 1
• NCBI Official Synonym Full Names: low density lipoprotein receptor
• NCBI Official Symbol: LDLR
• NCBI Official Synonym Symbols: FH; FHC; LDLCQ2
• NCBI Protein Information: low-density lipoprotein receptor; LDL receptor; low-density lipoprotein receptor class A domain-containing protein 3
• UniProt Protein Name: Low-density lipoprotein receptor
• Protein Family: LDLR chaperone
• UniProt Gene Name: LDLR
• UniProt Synonym Gene Names: LDL receptor
• UniProt Entry Name: LDLR_HUMAN

NCBI Description

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2010]

Uniprot Description

LDLR: Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells. Defects in LDLR are the cause of familial hypercholesterolemia (FH); a common autosomal semi- dominant disease that affects about 1 in 500 individuals. The receptor defect impairs the catabolism of LDL, and the resultant elevation in plasma LDL-cholesterol promotes deposition of cholesterol in the skin (xanthelasma), tendons (xanthomas), and coronary arteries (atherosclerosis). Belongs to the LDLR family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: Golgi apparatus; cell surface; membrane; integral to plasma membrane; lysosome; late endosome; early endosome; plasma membrane; endosome membrane; coated pit; receptor complex; external side of plasma membrane

Molecular Function: low-density lipoprotein receptor activity; very-low-density lipoprotein receptor activity; protein binding; low-density lipoprotein binding; clathrin heavy chain binding; calcium ion binding; glycoprotein binding

Biological Process: lipoprotein catabolic process; cholesterol metabolic process; phototransduction, visible light; receptor-mediated endocytosis; cholesterol transport; viral reproduction; cholesterol absorption; endocytosis; lipoprotein metabolic process; cholesterol homeostasis; phospholipid transport; lipid metabolic process; retinoid metabolic process

Disease: Hypercholesterolemia, Familial