Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Mouse anti-Human LBX1 Monoclonal Antibody | anti-LBX1 antibody
LBX1 (LBX1H, Transcription Factor LBX1, Ladybird Homeobox Protein Homolog 1)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LBX1; Monoclonal Antibody; LBX1 (LBX1H; Transcription Factor LBX1; Ladybird Homeobox Protein Homolog 1); Anti -LBX1 (LBX1H; anti-LBX1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B2
Specificity
Recognizes human LBX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA
Applicable Applications for anti-LBX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Recombinant corresponding to aa133-219 from LBX1 (NP_006553) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.57kD).)
Related Product Information for anti-LBX1 antibody
This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
Product Categories/Family for anti-LBX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
30,221 Da
NCBI Official Full Name
Lbx1 transcription factor
UniProt Protein Name
Transcription factor LBX1
Protein Family
UniProt Gene Name
LBX1
UniProt Synonym Gene Names
LBX1H
UniProt Entry Name
LBX1_HUMAN
Uniprot Description
LBX1: Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: 10q24
Cellular Component: transcription factor complex; nucleus
Molecular Function: sequence-specific DNA binding; transcription factor activity
Biological Process: neuron fate determination; negative regulation of cell proliferation; anatomical structure morphogenesis; muscle development; negative regulation of neuron differentiation; transcription, DNA-dependent; heart looping; spinal cord motor neuron differentiation; regulation of transcription from RNA polymerase II promoter involved in spinal cord association neuron specification
Similar Products
Product Notes
The LBX1 lbx1 (Catalog #AAA6009367) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LBX1 (LBX1H, Transcription Factor LBX1, Ladybird Homeobox Protein Homolog 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LBX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LBX1 lbx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TNHQIYELEK RFLYQKYLSP ADRDQIAQQL GLTNAQVITW FQNRRAKLKR DLEEMKADVE SAKKLGPSGQ MDIVALAELE QNSEATA. It is sometimes possible for the material contained within the vial of "LBX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
