Mouse anti-Human LASS1 Monoclonal Antibody | anti-LASS1 antibody

LASS1 (CerS1, LAG1, MGC90349, UOG1, LAG1 Longevity Assurance Homolog 1, Longevity Assurance Gene 1 Protein Homolog 1, Protein UOG-1) (HRP)

Cat. Num. AAA6153275

• Gene Names: CERS1; LAG1; UOG1; LASS1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LASS1; Monoclonal Antibody; LASS1 (CerS1; LAG1; MGC90349; UOG1; LAG1 Longevity Assurance Homolog 1; Longevity Assurance Gene 1 Protein Homolog 1; Protein UOG-1) (HRP); anti-LASS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E8
• Specificity: Recognizes human LASS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LASS1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-350 from human LASS1 (NP_067090) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.61kD).)

Related Product Information for anti-LASS1 antibody

Involved in the biogenesis of the 60S ribosomal subunit. Required for maturation of the 28S rRNA. Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes.

Product Categories/Family for anti-LASS1 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 11641421
• NCBI GeneID: 10715
• NCBI Accession #: NP_067090.1
• NCBI GenBank Nucleotide #: NM_021267
• UniProt Accession #: P27544
• Molecular Weight: 39536
• NCBI Official Full Name: ceramide synthase 1 isoform 1
• NCBI Official Synonym Full Names: ceramide synthase 1
• NCBI Official Symbol: CERS1
• NCBI Official Synonym Symbols: LAG1; UOG1; LASS1
• NCBI Protein Information: ceramide synthase 1; protein UOG-1; upstream of GDF1; longevity assurance gene 1 protein homolog 1; longevity assurance (LAG1, S. cerevisiae) homolog 1
• UniProt Protein Name: Ceramide synthase 1
• UniProt Gene Name: CERS1
• UniProt Synonym Gene Names: LAG1; LASS1; UOG1; CerS1
• UniProt Entry Name: CERS1_HUMAN

NCBI Description

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Isoform 1: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Note: Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.

Miscellaneous: This protein is produced by a bicistronic gene which also produces the GDF1 protein from a non-overlapping reading frame.

Sequence similarities: Contains 1 TLC (TRAM/LAG1/CLN8) domain.