Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LARS2 Monoclonal Antibody | anti-LARS2 antibody

LARS2 (KIAA0028, Probable Leucine-tRNA Ligase, Mitochondrial, Leucyl-tRNA Synthetase) (PE)

Gene Names
LARS2; LEURS; PRLTS4
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LARS2; Monoclonal Antibody; LARS2 (KIAA0028; Probable Leucine-tRNA Ligase; Mitochondrial; Leucyl-tRNA Synthetase) (PE); anti-LARS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F12
Specificity
Recognizes human LARS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LARS2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa806-904 from LARS2 (NP_056155) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-LARS2 antibody
This gene encodes a class 1 aminoacyl-tRNA synthetase, mitochondrial leucyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid.
Product Categories/Family for anti-LARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,976 Da
NCBI Official Full Name
probable leucine--tRNA ligase, mitochondrial
NCBI Official Synonym Full Names
leucyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
LARS2
NCBI Official Synonym Symbols
LEURS; PRLTS4
NCBI Protein Information
probable leucine--tRNA ligase, mitochondrial; leucine tRNA ligase 2, mitochondrial; leucine tRNA ligase 2, mitocondrial; leucine translase; probable leucyl-tRNA synthetase, mitochondrial
UniProt Protein Name
Probable leucine--tRNA ligase, mitochondrial
UniProt Gene Name
LARS2
UniProt Synonym Gene Names
KIAA0028; LeuRS
UniProt Entry Name
SYLM_HUMAN

Uniprot Description

LARS2: a class 1 aminoacyl-tRNA synthetase, mitochondrial leucyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. [provided by RefSeq, Jul 2008]

Protein type: Translation; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis; Mitochondrial; Ligase; EC 6.1.1.4

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: mitochondrion; mitochondrial matrix; cytosol

Molecular Function: leucine-tRNA ligase activity; ATP binding

Biological Process: leucyl-tRNA aminoacylation; tRNA aminoacylation for protein translation; regulation of translational fidelity; gene expression

Disease: Perrault Syndrome 4

Similar Products

Product Notes

The LARS2 lars2 (Catalog #AAA6158576) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LARS2 (KIAA0028, Probable Leucine-tRNA Ligase, Mitochondrial, Leucyl-tRNA Synthetase) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LARS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LARS2 lars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LARS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.