Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human Laminin, beta 3 Monoclonal Antibody | anti-LAMB3 antibody

Laminin, beta 3 (Laminin Subunit beta-3, LAMB3, BM600-125kDa, FLJ99565, Epiligrin Subunit bata, Laminin-5 Subunit beta, LAM5, Kalinin Subunit beta, Nicein Subunit beta, Laminin B1k Chain, LAMNB1, Kalinin B1 Chain) (PE)

Gene Names
LAMB3; AI1A; LAM5; LAMNB1; BM600-125KDA
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Laminin; beta 3; Monoclonal Antibody; beta 3 (Laminin Subunit beta-3; LAMB3; BM600-125kDa; FLJ99565; Epiligrin Subunit bata; Laminin-5 Subunit beta; LAM5; Kalinin Subunit beta; Nicein Subunit beta; Laminin B1k Chain; LAMNB1; Kalinin B1 Chain) (PE); anti-LAMB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G10
Specificity
Recognizes human LAMB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LAMB3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1064-1171 from human LAMB3 (NP_000219) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(LAMB3 monoclonal antibody Western Blot analysis of LAMB3 expression in A-431.)

Western Blot (WB) (LAMB3 monoclonal antibody Western Blot analysis of LAMB3 expression in A-431.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LAMB3 on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LAMB3 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LAMB3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LAMB3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-LAMB3 antibody
References
1. Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma. Kita Y, Mimori K, Tanaka F, Matsumoto T, Haraguchi N, Ishikawa K, Matsuzaki S, Fukuyoshi Y, Inoue H, Natsugoe S, Aikou T, Mori M.Eur J Surg Oncol. 2009 Jan;35(1):52-58. Epub 2008 Mar 10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129,572 Da
NCBI Official Full Name
laminin subunit beta-3
NCBI Official Synonym Full Names
laminin, beta 3
NCBI Official Symbol
LAMB3
NCBI Official Synonym Symbols
AI1A; LAM5; LAMNB1; BM600-125KDA
NCBI Protein Information
laminin subunit beta-3; epiligrin subunit bata; kalinin B1 chain; kalinin subunit beta; kalinin-140kDa; laminin B1k chain; laminin S B3 chain; laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)); laminin-5 subunit beta; nicein subunit beta; n
UniProt Protein Name
Laminin subunit beta-3
Protein Family
UniProt Gene Name
LAMB3
UniProt Synonym Gene Names
LAMNB1
UniProt Entry Name
LAMB3_HUMAN

Uniprot Description

LAMB3: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Defects in LAMB3 are a cause of epidermolysis bullosa junctional Herlitz type (H-JEB); also known as junctional epidermolysis bullosa Herlitz-Pearson type. JEB defines a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement membrane. H-JEB is a severe, infantile and lethal form. Death occurs usually within the first six months of life. Occasionally, children survive to teens. H-JEB is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic. Defects in LAMB3 are a cause of generalized atrophic benign epidermolysis bullosa (GABEB). GABEB is a non- lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: laminin-5 complex; extracellular region

Molecular Function: protein binding; protein complex binding; structural molecule activity

Biological Process: extracellular matrix disassembly; epidermis development; hemidesmosome assembly; extracellular matrix organization and biogenesis; brown fat cell differentiation; cell adhesion

Disease: Epidermolysis Bullosa, Junctional, Non-herlitz Type; Epidermolysis Bullosa, Junctional, Herlitz Type; Amelogenesis Imperfecta, Type Ia

Similar Products

Product Notes

The LAMB3 lamb3 (Catalog #AAA6158572) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Laminin, beta 3 (Laminin Subunit beta-3, LAMB3, BM600-125kDa, FLJ99565, Epiligrin Subunit bata, Laminin-5 Subunit beta, LAM5, Kalinin Subunit beta, Nicein Subunit beta, Laminin B1k Chain, LAMNB1, Kalinin B1 Chain) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Laminin, beta 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAMB3 lamb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Laminin, beta 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.