Mouse anti-Human LAMC1 Monoclonal Antibody | anti-LAMC1 antibody

LAMC1 (Laminin Subunit gamma-1, Laminin B2 Chain, Laminin-1 Subunit gamma, Laminin-10 Subunit gamma, Laminin-11 Subunit gamma, Laminin-2 Subunit gamma, Laminin-3 Subunit gamma, Laminin-4 Subunit gamma, Laminin-6 Subunit gamma, Laminin-7 Subunit gamma, Lam

Cat. Num. AAA6142662

• Gene Names: LAMC1; LAMB2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LAMC1; Monoclonal Antibody; LAMC1 (Laminin Subunit gamma-1; Laminin B2 Chain; Laminin-1 Subunit gamma; Laminin-10 Subunit gamma; Laminin-11 Subunit gamma; Laminin-2 Subunit gamma; Laminin-3 Subunit gamma; Laminin-4 Subunit gamma; Laminin-6 Subunit gamma; Laminin-7 Subunit gamma; Lam; anti-LAMC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: M1
• Specificity: Recognizes human LAMC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-LAMC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-38 from human LAMC1 (AAH15586) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (29.92kD).)

Testing Data

(Detection limit for recombinant GST tagged LAMC1 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between LAMA5 and LAMC1 HeLa cells were stained with LAMA5 rabbit purified polyclonal 1:1200 and LAMC1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-LAMC1 antibody

Laminins are large heterotrimeric, non-collagenous glycoproteins composed of alpha, beta, and gamma chains. They are ubiquitously present in basement membrane (BM) along with entactin/nidogen (EN), collagen type IV (CIV), large heparan sulfate proteoglycan (HSPG), which interact specifically with each other to form a continuous and regular BM. Alterations of BM integrity, from local discontinuities up to complete loss, are described in many types of human and animal epithelial neoplasms.

Product Categories/Family for anti-LAMC1 antibody

Antibodies; Lamin; Laminin

NCBI and Uniprot Product Information

• NCBI GI #: 33874571
• NCBI GeneID: 3915
• Molecular Weight: 177,603 Da
• NCBI Official Full Name: Homo sapiens laminin, gamma 1 (formerly LAMB2), mRNA
• NCBI Official Synonym Full Names: laminin subunit gamma 1
• NCBI Official Symbol: LAMC1
• NCBI Official Synonym Symbols: LAMB2
• NCBI Protein Information: laminin subunit gamma-1
• Protein Family: Laminin

NCBI Description

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins, composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively), have a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. [provided by RefSeq, Aug 2011]